KEGG   Corynebacterium ulcerans 0102: CULC0102_0641Help
Entry
CULC0102_0641     CDS       T02171                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CULC0102_0641 (rbsK)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CULC0102_0641 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(653889..654791)
Genome map
AA seq 300 aa AA seqDB search
MLKTVAVVGSINADLSVRVQRHPNPGETVLGMDSSVSPGGKGANQAVAAALQGAKVIFVG
AVGKDAYAEPALELLRTSNVCLDHISEVEGPTGTAVITVSEDGENSIIVIPGANAAVDAA
CVATHAETIANADIVLLQGEIPADGFQETIKTATGRVVVNLAPVIPVDREALLKADPIMA
NEHEANLILEQLGSSINSDDPHELAQELLAQGFASVVLTLGSKGALVADPASSVMVPSPK
VTAVDTTGAGDAFAGDFVAQLLGGASPVEAAQHAVRVGAYAVQYRGAQASYPHADAELPR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagactgttgccgtcgtaggctctatcaacgcagatttaagcgtgcgtgttcag
cggcatcccaacccgggagagaccgtcctcggcatggatagttccgtttcccccggtggc
aaaggcgccaaccaggcagtagcggcagctctccaaggggcaaaagtgatctttgtcggc
gctgtgggcaaagatgcctacgcagaaccagctctggagttactgcgtacttccaacgta
tgtctggaccatatctcggaggtcgaaggccccacgggcaccgcagtcatcacagtttct
gaagacggggaaaactccatcattgtgatccctggcgcgaatgccgctgtcgacgccgcc
tgcgtcgccacgcatgcagaaaccattgcgaacgcagatatcgtgctcctgcagggagaa
atccccgccgatgggttccaggaaacgatcaagaccgcaactggtcgcgttgtggtcaat
cttgctcccgttattcctgtggatcgcgaagcattgcttaaagcagaccccatcatggct
aacgagcacgaggccaacctcatcctggaacagctcggcagtagcatcaacagcgatgat
ccgcacgagctcgctcaagaactattggcacagggttttgcctcggttgtcctcacacta
ggaagcaagggtgcacttgtggcagaccctgcgtccagcgtcatggtgccttcgccaaaa
gtaacagcagtggacacaaccggagcaggcgatgccttcgctggagactttgtagcccaa
ttgctcggtggggcgtcgcctgtggaagccgcccagcatgcggtccgtgtcggggcctac
gccgtgcagtatcgaggcgcccaagcctcctacccacacgcggacgctgaactcccccgc
tag

DBGET integrated database retrieval system