KEGG   Corynebacterium ulcerans 0102: CULC0102_0822Help
Entry
CULC0102_0822     CDS       T02171                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CULC0102_0822 (galU)
   00052 Galactose metabolism
    CULC0102_0822 (galU)
   00500 Starch and sucrose metabolism
    CULC0102_0822 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC0102_0822 (galU)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CULC0102_0822 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
851649..852578
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRAAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGLAETVLDPEEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESTYEGPYHVKKVKGMVEKPSVDEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPVYGPHLKKAL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgccgcggtaaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttccggccacaaaaacggttcctaaagagctg
ttgccagtggtggatactccaggcattgaactgattgcagaagaagcagctcagttgggt
gcgactcgactcgcagtgattacagctcctaataaacaggaagttatggagcactttaag
cgattcccagtgcttgaagagaccctgcaaagtcgagggaaaacggaacaatatgagaaa
gtggtccacgcctctgaacttattgccccggtatctgtagtgcaggaaaaaccgcttggc
ctcgggcacgcagtcggtttggcggaaacagttcttgatccggaagaagacgccgtagct
gtcatgcttcccgatgacctcgtgctcccgcgtggcgttgtggaaaagatggttgaggtg
cgtgaacagctaggcggatctgtgctgtgcgcctttgaagttccagaggaagaagtctat
aactacggtgtttttgagattgatgagagcacatacgagggcccttatcacgtcaaaaaa
gtcaaaggaatggtggagaagccttctgtagatgaagctccctcaaattttgtagcgact
ggtcgctatctgctggaccgggctattttcgacgccctacgcaggattacgccgggcgct
ggcggtgaattgcagctcacggatgctatcgatttgcttatcgacgaaggccatcccgta
cacatcctcgtgcacgatggaaagcgacatgaccttggtaatcctggtggatatataccg
gctgtcgttgactttgggctgagcgacccagtgtatggcccccacttaaaaaaggctctc
cgaaagatcctggaagaacacggcgcctaa

DBGET integrated database retrieval system