KEGG   Corynebacterium ulcerans 0102: CULC0102_0822Help
Entry
CULC0102_0822     CDS       T02171                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00040  Pentose and glucuronate interconversions
cue00052  Galactose metabolism
cue00500  Starch and sucrose metabolism
cue00520  Amino sugar and nucleotide sugar metabolism
cue01100  Metabolic pathways
cue01130  Biosynthesis of antibiotics
Module
cue_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CULC0102_0822 (galU)
   00052 Galactose metabolism
    CULC0102_0822 (galU)
   00500 Starch and sucrose metabolism
    CULC0102_0822 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC0102_0822 (galU)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CULC0102_0822 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAM27021
Position
851649..852578
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRAAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGLAETVLDPEEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESTYEGPYHVKKVKGMVEKPSVDEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPVYGPHLKKAL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgccgcggtaaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttccggccacaaaaacggttcctaaagagctg
ttgccagtggtggatactccaggcattgaactgattgcagaagaagcagctcagttgggt
gcgactcgactcgcagtgattacagctcctaataaacaggaagttatggagcactttaag
cgattcccagtgcttgaagagaccctgcaaagtcgagggaaaacggaacaatatgagaaa
gtggtccacgcctctgaacttattgccccggtatctgtagtgcaggaaaaaccgcttggc
ctcgggcacgcagtcggtttggcggaaacagttcttgatccggaagaagacgccgtagct
gtcatgcttcccgatgacctcgtgctcccgcgtggcgttgtggaaaagatggttgaggtg
cgtgaacagctaggcggatctgtgctgtgcgcctttgaagttccagaggaagaagtctat
aactacggtgtttttgagattgatgagagcacatacgagggcccttatcacgtcaaaaaa
gtcaaaggaatggtggagaagccttctgtagatgaagctccctcaaattttgtagcgact
ggtcgctatctgctggaccgggctattttcgacgccctacgcaggattacgccgggcgct
ggcggtgaattgcagctcacggatgctatcgatttgcttatcgacgaaggccatcccgta
cacatcctcgtgcacgatggaaagcgacatgaccttggtaatcctggtggatatataccg
gctgtcgttgactttgggctgagcgacccagtgtatggcccccacttaaaaaaggctctc
cgaaagatcctggaagaacacggcgcctaa

DBGET integrated database retrieval system