KEGG   Corynebacterium ulcerans 0102: CULC0102_0936Help
Entry
CULC0102_0936     CDS       T02171                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CULC0102_0936 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CULC0102_0936 (dapE)
Enzymes [BR:cue01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CULC0102_0936 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977327..978400
Genome map
AA seq 357 aa AA seqDB search
MLDLTANPIELTRALVDIESPSHHEKHIADLIEQALKSIPHVEVLRHGNTVVARTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANAEDLTQDLT
IVCYEGEEVSSEFNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITARGVR
AHSARSWLGTNAMHLLAPVISRIADYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDEAMAHLLETLSLPSDVSYEVDDAVPGARPGLDRPAAAALLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPSYCHKKDEQCPVHMITDVSNTLLAYLRA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctaaccccattgaactcacccgcgcactcgtggatattgaaagc
ccttcccaccacgagaagcacattgcggatctgatcgaacaagccttgaagtccattcct
cacgtcgaggtgctacgacatgggaacaccgtggtcgctcgcacgcatcggggactagga
agcagagttatcctcgccgggcacatcgatacagtccccacagcagataacgtcccttcc
actctcatcgacgacgtactctttggctgcggaaccgtcgacatgaaatctggcatggct
gtatatctgcacgcttttgccacactcgccaacgccgaagacttaacgcaagacctgaca
atcgtttgctacgagggtgaggaagtctccagcgaattcaacggattaggccatctgcaa
caagcgcatcctgagtggctccagggtgacatcgcgttactaggagagccatcaggtgcc
gtcattgaagccggctgccaaggatccatccgcctccggatcacagcacgcggagtgcgg
gcgcattcggcacgttcgtggctaggaacgaatgccatgcatctcctagcgccggttatc
tcccgcatcgctgactacgaagcgcaggaaaagcttgtcgacgcctgcctttaccacgaa
gggctcaacatcgtgcactgcgaatccggcgtggccaccaacaccattcccgacgaagca
tggatgtttgtgaactttcgttttgctccggatcgcagcctcgatgaggcgatggcgcac
ttgttggaaaccctctcccttcctagcgacgtcagctatgaggtagatgatgcggttcca
ggggcgcgccctgggttggatcgtccggccgctgctgctctcctacgcgcaacaggtgga
aaattccgtgctaaatatggttggactgatgtgtcgcgtttttctgaaatgggaatcccc
gcagttaactttggtcctggcgacccttcctactgccataagaaggacgagcagtgcccg
gtccacatgatcacagatgtctccaacaccttgttggcttacctacgcgcctag

DBGET integrated database retrieval system