KEGG   Corynebacterium ulcerans 0102: CULC0102_0938Help
Entry
CULC0102_0938     CDS       T02171                                 

Gene name
folP1
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CULC0102_0938 (folP1)
Enzymes [BR:cue01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CULC0102_0938 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979193..980050
Genome map
AA seq 285 aa AA seqDB search
MPRSAFLGTEGLATVMAIVNRTPDSFYDHGATHAFDAAVERAGAVIAAGAGIVDIGGVKA
GPGEFVSISEEIDRVVPVIAAVHEAFPDTTISVDTWRAEVAELAVDAGASLINDTWAGHD
PELVEVAGDRRVGYVCSHTGGVVPRTRPYRVHYDDVVSAVIDETTRQAEHAVSLGVPEDK
IFIDPTHDFGKNTFHGLELLRRIDDIVATGWPVLMALSNKDFIGETLARSVDKRVSGTLA
ATAWSAERGVAAFRSHQIEETIDVIRMTAAIQGTIPPLKTTRGLA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggagcgccttcctaggcactgaaggcttggccacggtaatggcgatcgtgaat
aggacgcccgattccttttacgatcacggtgcgactcatgctttcgacgctgcagtcgaa
cgcgctggtgcagtgattgcggccggcgctgggatcgtggacattggtggggtcaaagct
ggaccgggcgaattcgtatcaatctctgaagaaatagaccgtgtagtgccggtgatcgct
gcggtgcatgaagcctttcccgatacgaccatctcggtggacacgtggcgcgcggaagtc
gccgaattggctgtcgacgcaggagcatcactcatcaacgacacatgggcaggccacgat
ccagagctcgtggaggtcgctggcgatcgtcgagttggctatgtctgctcgcacaccggc
ggagtggtccctaggacaaggccgtatcgcgtgcattacgacgacgtggtgtccgcagtt
atcgacgaaactacgcggcaagcggaacatgcagtgtccctaggagtgccagaagacaag
atattcattgaccccacgcatgatttcggcaaaaacacttttcacgggcttgaactttta
cgccgaatcgatgacatcgtggcgaccggctggccagtcctcatggcgctgtccaataag
gactttattggggaaacgcttgcgcggagcgtcgataagcgtgtctctggaaccttggcg
gcaacggcgtggtctgcggaacgaggcgtggcggcgtttcgttcgcatcaaatagaagag
acaatcgacgtgattaggatgacggcggcgattcaaggaacgattcctccactgaaaaca
accagaggtctggcgtga

DBGET integrated database retrieval system