KEGG   Corynebacterium ulcerans 0102: CULC0102_1040Help
Entry
CULC0102_1040     CDS       T02171                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC0102_1040 (pfkA)
   01230 Biosynthesis of amino acids
    CULC0102_1040 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC0102_1040 (pfkA)
   00030 Pentose phosphate pathway
    CULC0102_1040 (pfkA)
   00051 Fructose and mannose metabolism
    CULC0102_1040 (pfkA)
   00052 Galactose metabolism
    CULC0102_1040 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CULC0102_1040 (pfkA)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CULC0102_1040 (pfkA)
Protein phosphatases and associated proteins [BR:cue01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CULC0102_1040 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1087978..1089006
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDINEVCKAMERRFQMGEKYGIIVVAEGALPKEGTMSFDQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPDARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctccggtggcgattgtcccggactcaacgctgttatccgc
ggtatcgtccgcacgtgttccgaatatggttctaccgttgtggggtacgaggacggttgg
gttggtctcatggaagacaaacgcattcaactgtacgacgatgaaaatatcgatcgtatt
cttttacgcggcggaacgatcttgggaactggtcgtcttcacccagataagttcaaagca
ggacttgaacaaattaaagagaatctggcagatgcggaaattgacgcattgattcctatc
ggcggcgaaggcactctcaaaggtgctcagtggctttctgataacgggatccccgtggtc
ggcgtgccaaaaactattgataatgatgtcaacggaaccgattacaccttcggttttgac
acagcggtgtcagtagcaaccgatgccattgaccgtctccataccacggcagagtcccac
aaccgcgtgatgattgtggaagtgatgggacgccatgtcggatggatcgcgctgcacgcc
ggaatggcaggcggggcgcactatacagtcatcccggagcagccttttgacatcaatgag
gtctgcaaagcaatggaacgtcgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggtgccttgcctaaggaaggaacgatgagctttgaccaaggatgcgtagatcag
tttggtcatcaaacctttaacggcatcggtcaggtgatcggggaagagataaagaggcgc
ctaggccacgatgtgcgtactaccgtgcttggacacatccagcgtggtggcaccccaacc
gcctatgatcgtgtcttggcaacccgatatggtgtccatgctgcacgtgcatgtcatacg
caggattttggcaagatggtggcacttcacggtgagcatattgacttgattcctttggaa
gaagccgtaggaacgttgaaggtagttcctgatgcccggtatcggactgctagagcgctc
ttcggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system