KEGG   Corynebacterium ulcerans 0102: CULC0102_1335Help
Entry
CULC0102_1335     CDS       T02171                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00010  Glycolysis / Gluconeogenesis
cue00051  Fructose and mannose metabolism
cue00562  Inositol phosphate metabolism
cue01100  Metabolic pathways
cue01110  Biosynthesis of secondary metabolites
cue01120  Microbial metabolism in diverse environments
cue01130  Biosynthesis of antibiotics
cue01200  Carbon metabolism
cue01230  Biosynthesis of amino acids
Module
cue_M00002  Glycolysis, core module involving three-carbon compounds
cue_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC0102_1335 (tpi)
   00051 Fructose and mannose metabolism
    CULC0102_1335 (tpi)
   00562 Inositol phosphate metabolism
    CULC0102_1335 (tpi)
Enzymes [BR:cue01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CULC0102_1335 (tpi)
Exosome [BR:cue04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CULC0102_1335 (tpi)
  Exosomal proteins of bladder cancer cells
   CULC0102_1335 (tpi)
  Exosomal proteins of melanoma cells
   CULC0102_1335 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAM27534
Position
complement(1427302..1428081)
Genome map
AA seq 259 aa AA seqDB search
MERTPLIAGNWKMNLDHLKAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTVVDGD
KLQITYGAQDVSEHESGAYTGEISADMLAKLGCTWVVVGHSERREYHGESSKLVAAKAKA
ALGKGISPIVCVGEPLEIREAGTHVDFVVEQTRESLAGLTEAELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLVKELANEEIAEGVRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtacgccgctcatcgctggtaactggaagatgaacttagaccacttgaaagct
gtggcaacagttcagaagctagcctttgcacttcctaaggagtactacgagaaggtcgat
gttgcagttaccgtaccttttacggatctgcggtctgttcagactgtagttgatggcgat
aagcttcagatcacctacggtgcccaagacgtatcagagcatgaatcaggtgcttatacc
ggcgaaatctctgcagatatgctcgcaaagctcggttgcacatgggttgtcgttggacac
tcggagcgtcgtgaataccatggcgagtcctcgaaacttgttgctgcgaaggctaaagca
gcgctgggcaaaggcataagcccgatcgtttgcgtcggtgagcctttggagatccgggaa
gctggcactcacgtagattttgtcgtcgagcaaacccgtgaatcacttgctggtctgact
gaagccgaactagctaagaccgttattgcttatgagccggtgtgggcaattggcactggc
aaggtcgcttctgcggctgatgctcaagaagtatgtaaagcgatccgtggtttagttaaa
gaacttgcaaatgaggaaatcgctgaaggcgttcgtattctttacggtggctctgtaaag
gaagaaacggtcgcagaaatagtcggacagcccgacgtagacggtggtcttgttggtggc
gcttctctcgacggtgaggcatttgccaaacttgctgctaacgcagcgactggtctttag

DBGET integrated database retrieval system