KEGG   Corynebacterium ulcerans 0102: CULC0102_1400Help
Entry
CULC0102_1400     CDS       T02171                                 

Gene name
ruvA
Definition
holliday junction resolvasome helicase subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cue03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503861..1504475)
Genome map
AA seq 204 aa AA seqDB search
MIVSLRGTVASIGLGSAVIECNGVGYEVLASPSTLAHMSRGEEFFVLTTMVVREDSQTLY
GFASDEARQMFTLLQTVSGLGPKLALAAQSVLSATDLAHAIANQDAKTLQRIPGVGKRVA
ERIIVDLKDKVSAFITAGDAATPAPGGVSLATNDVAAQVLEALLGLGFTEKVAEPVVISV
LADSPNATTSQVLRLALSALGKKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcccttcgcgggactgtagcctccatcggtcttggtagcgcagttattgag
tgcaacggggtcggatatgaagtactcgctagtcccagcaccttggcgcacatgagcagg
ggagaagagttctttgttctgaccaccatggtggtcagagaagattcccaaaccctttac
gggtttgccagcgatgaagctcggcagatgtttacgctgctgcaaacagtctctggtcta
ggaccaaaactggctctggcagcgcaatcggttttgtccgcaacagatctagcgcatgcg
attgctaaccaggatgcaaagactctccagcgcataccgggagtgggaaaacgagttgca
gagcgcatcatcgttgacctcaaagacaaggtttcagcgtttattaccgctggagatgct
gccactcccgcgccgggaggagtttctttagcaaccaacgatgttgctgcgcaagtactt
gaggctctcctcggcctcggctttacagaaaaagttgcagaacctgtggtgatttccgtg
ttagctgattctccgaatgcgaccacgtcccaggtgctgcgtctagccctgagtgcgctg
ggcaaaaagaaatag

DBGET integrated database retrieval system