KEGG   Corynebacterium ulcerans 0102: CULC0102_1518Help
Entry
CULC0102_1518     CDS       T02171                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC0102_1518
Enzymes [BR:cue01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CULC0102_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628861..1629955)
Genome map
AA seq 364 aa AA seqDB search
MSTGGRTLYPFSAVVGQDRLRLALILCAISPRIGGVVIRGEKGTAKTTTVRAFASLLGDA
PLVDLPIGATEDRVVGSLDMETILTTGKAHYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVVASKDVEVR
AEIMRRRLAFESTPQSFVQSWAHEDASTAQLIHEAKQRVQQLQLSDVNLSRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASTVEDEDIRIAAELALPHRRRRDPFDEPGLDQDQLDQ
EMDNAQKQHPDEEGNAESDSEGPQDEANQNEVEEKSSEEQAEQPTSDGQEERATTGAPFR
SAGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcactggtggacgtacgttgtatccgttttcggcagttgtggggcaggatcgacta
agacttgcactcatcctgtgtgcgatttctccgcgcattggtggcgtggtcatccgtggg
gaaaagggaacagccaagacaaccacggtgcgagcttttgccagtttgctgggggatgct
ccattagttgatcttcccatcggagccacggaagatcgagttgtgggctcccttgacatg
gaaacgatcttgaccacgggcaaggctcactataatcccggtttgctgagccaggcagac
ggtggagtgctgtacgtcgatgaggtaaatctgcttgcggatcacctggttgattcgctc
ttagacgccgcagcgacagggcaggttacagtcgaacgggacggtatttcgcattcttct
cctgccaattttgtgcttgtgggaaccatgaatccagaggaaggagagctgcgtccgcag
cttcttgatcgttttggtttggccgtcgatgtcgtggcctccaaagatgttgaggttcgt
gcagagatcatgcggcgtcggctcgcatttgaatcgactccacaatcttttgttcaatca
tgggcccatgaggacgcatcaacagcgcagctgatccatgaggcgaaacaacgagtgcag
cagctacagctttccgacgttaacctcagccggattgcacacctttgtgcggcatttgat
gttgatggtatgagggctgatttggttattgctcggactgcgctagcccacgctgcctgg
cgcggggcctcgacggtggaagatgaggatattcgcatagctgcagagttggctttgccg
catcgtcgccgcagagacccattcgatgaacccggcttagatcaggatcagctggatcaa
gaaatggataatgctcagaaacagcacccagatgaggaaggcaacgcggaaagcgactcg
gaaggacctcaggacgaggcaaatcagaatgaagtagaagaaaaatcctcggaagaacag
gcggaacagcccaccagtgatggtcaggaggaacgcgctactactggcgctccctttcgc
tccgcgggtgtttaa

DBGET integrated database retrieval system