KEGG   Corynebacterium ulcerans 0102: CULC0102_1635Help
Entry
CULC0102_1635     CDS       T02171                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cue00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cue00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761331..1762842)
Genome map
AA seq 503 aa AA seqDB search
MSGKERALVTLGSLAALTGGELHGDKDIVIEDISLDSQELPQGGLFAALPGTRSHGAVYA
QGTQAAAILTDAAGAAILHESGDTRPRLLVENVRDILGVVSAEIYGHPSESLQVIGITGT
SGKTTTSYMLEAGLINAGKTVGLIGTTGTRINGVKIPTKLTTPEAPMLQKLFAQMLDQGV
THVVMEVSSHALSLGRVSATHFAAAGFTNLSQDHLDFHPTMEEYFEAKAVLFDPASVVHT
NKAVVCIDDPWGLQMLERSGADALSVSTSAEKQADFAVSGLTVDAAGGQRFVVTHKDRNI
DVDLPIPGAFNVANAALAVGLASSIGIDLDRFVAGLTAVSVPGRMERVNRGQDFLAIVDY
AHKPAAVAAVLDAVRRQAAGRVAIVVGAGGDRDKGKRSIMGEESARRADLVIVTDDNPRS
EDPALIREAVLRGAREAATTAEIREIGDRREAIKQAVAWARPTDAVIIAGKGHEVGQLIQ
GINHHFDDREELAAALEEIRNNS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaagagcgtgccttggtaacgctgggttctctggcagcgttaacaggtggt
gaactccacggtgacaaggacatcgtcattgaggacatcagtcttgattcccaggagctt
cctcaaggagggctctttgctgcgcttccggggacccgcagccacggcgctgtgtatgct
caaggaactcaagcagctgcgattttgacggatgctgctggtgcggcgattttgcacgag
agcggtgatacccgcccgcgtctgttagtcgagaacgtccgggacattcttggtgtagtc
agcgctgagatctacgggcatccttcagagtcactacaggtcattgggattactggcacc
agtggtaaaactacaacgagctatatgcttgaagctggtctgattaatgctggaaaaaca
gttgggctcatcggcactaccgggactcggatcaatggggtgaagatcccgacaaaactc
accactcctgaagccccgatgctacaaaagctatttgctcagatgcttgaccagggcgta
acccatgtggtgatggaagtatccagtcacgctttgtccctggggcgggtatcggctaca
catttcgctgcagctggttttaccaacctctcccaagatcatctggactttcatccgacg
atggaagaatactttgaggcgaaagcagtgctgtttgatccagcctctgtcgtacataca
aataaggcagttgtgtgtatagacgacccatggggtctgcagatgctagaacgaagtggc
gcggatgccctatcagtgtctacgagtgcggaaaaacaagcagattttgctgtctcggga
cttactgtggacgccgctggtggtcagcgttttgtggtgacacataaggatcggaatatt
gacgttgatctgcctattccaggggcctttaacgtagctaatgcagcacttgcagtaggt
ttggccagcagcataggtatcgaccttgatcgctttgttgcagggctcactgcggtaagt
gttcctgggcgtatggagcgggttaatcgaggccaagatttcttggcgatcgtagattat
gcacacaaacctgcggcagtggctgcggtattggacgcggttcgtcgtcaagcagctggg
cgcgtggccatagtagtgggcgctggtggcgatcgagacaaaggtaagcgctcaatcatg
ggggaggaatccgcgcgcagagctgatttagtgatcgttactgacgataatccgcgttcg
gaagatcctgcgctgattcgggaagccgttttgcgtggtgctcgtgaagccgcgacgact
gcggaaatccgtgagatcggggatcgtcgagaagctataaagcaagctgtggcgtgggca
aggcccactgatgccgtcattatcgcgggcaaaggccacgaggtaggacagctcatccag
ggaataaatcatcactttgatgaccgagaagagctggccgccgcgctcgaagagatacga
aataatagctag

DBGET integrated database retrieval system