KEGG   Corynebacterium ulcerans 0102: CULC0102_1673Help
Entry
CULC0102_1673     CDS       T02171                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC0102_1673 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC0102_1673 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CULC0102_1673 (sucB)
Enzymes [BR:cue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CULC0102_1673 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1802464..1804446
Genome map
AA seq 660 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FDEDDTVDVGEVIAIIGEEGEAPAASDSAEKKEEPKAEAQAEEETTTESKEAPKGSGSST
DVVMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEVLFNE
DDTVDVGEVIVRIGEPGSEPEAKAEPAKEEPKEEAPAEEEPAKEAPKGSGSSTDVVMPEL
GESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEVLFNEDDTVDVG
EVIVRIGEPGSEPETKAEPAKEEPKEEAPKAEEAPAKEAAKPVNNQNVPYVTPLVRKLAN
KHGVDLNKIEGTGVGGRIRKQDVLAAAGQGSEPVAAAAPAAAAKDPRANWSTKSVDPAKA
ELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKENKPAFIEKYGANL
TYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNVAIAVDTERGLLTPVIHKAQEL
TLPEIAQAIADLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILGTAA
IQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKNRLEKAKFQDDLNL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcgacgaagacgacaccgttgatgtcggcgaggttatcgccatcatcggtgaggaaggc
gaggctcctgcagcaagcgattccgctgagaagaaggaagagccgaaggcagaggcacaa
gccgaagaagaaaccacaactgaatccaaggaagctcccaagggctccggctcctccacc
gacgtggtcatgccagaactcggcgaatccgtcaccgaaggaacaatcacccagtggctc
aagtctgtcggcgacaccgtcgacgttgacgagccattgctcgaggtttccaccgacaag
gttgacaccgaggttccttccccagtggcaggcaccatcctagaagtcctcttcaacgaa
gacgacaccgttgatgtcggcgaagttatcgtccgcatcggcgaaccaggctccgaacca
gaagccaaggcagaacctgccaaggaagagccaaaggaagaagcaccagccgaagaagaa
cctgctaaggaagcacccaagggctccggctcctccaccgacgtggtcatgccagaactc
ggcgaatccgtcaccgaaggaacaatcacccagtggctcaagtctgtcggcgacaccgtc
gacgttgacgagccattgctcgaggtttccaccgacaaggttgacaccgaggttccttcc
ccagtggcaggcaccatcctagaagtcctcttcaacgaagacgacaccgttgatgtcggc
gaagttatcgtccgcatcggcgaaccaggctccgaaccagaaaccaaggcagaacctgcc
aaggaagagccaaaggaagaagctcccaaggctgaggaagcacctgctaaggaagctgca
aagccagttaataaccagaatgttccttacgtgaccccattggttcgtaagcttgccaac
aagcatggcgttgatctcaataagatcgaaggaactggtgttggcggtcgcatccgtaag
caggacgtccttgccgcagctggtcaaggatctgagccagttgcggcagcagctcctgct
gccgcggctaaggatcctcgcgctaactggtcaaccaagagcgttgaccctgcaaaggcg
gagctcataggcaccaccaagaaggtcaaccgcatccgcgagattacggccaagaagatg
gttgaggcactgcagatttctgcacagctcacgcaccttcaagaggtcgatatgaccaac
gttgcaacgctgcgcaaggaaaataagccggcattcatcgaaaagtatggcgctaacctg
acctatctgccgttctttgttaaggccgtggtcgaggctctggtcctacacccgaacgta
aacgcgtcttacaacgctgcaaccaaggaaatcacctaccactctgacgtcaatgtggcg
atcgcagtggacacagagcgtggcctgcttactcccgtgattcacaaggctcaggaactt
acgctgccagaaatcgcccaggctattgctgatctggctgatcgtgctcgtaacaacaag
ctgaagccaaatgatctctccggcgcaaccttcaccgtaaccaacattggctccgaaggt
gctctggcagatacaccaatcttggttccgccacaggtcggtatcttgggtactgctgca
atccagaagcgccccgtagtgatcactgaaaacggttcggacgccatcgcgattcgccag
atgtgctacatcccgttctcctatgaccaccagatcgtagacggtgctgacgcaggtcgc
ttcaccgcaacgattaagaatcgtttggaaaaggctaagttccaggacgacctcaacctc
tag

DBGET integrated database retrieval system