KEGG   Corynebacterium ulcerans 0102: CULC0102_1673Help
Entry
CULC0102_1673     CDS       T02171                                 

Gene name
sucB
Definition
dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cue01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cue00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cue00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802464..1804446
Genome map
AA seq 660 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FDEDDTVDVGEVIAIIGEEGEAPAASDSAEKKEEPKAEAQAEEETTTESKEAPKGSGSST
DVVMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEVLFNE
DDTVDVGEVIVRIGEPGSEPEAKAEPAKEEPKEEAPAEEEPAKEAPKGSGSSTDVVMPEL
GESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEVLFNEDDTVDVG
EVIVRIGEPGSEPETKAEPAKEEPKEEAPKAEEAPAKEAAKPVNNQNVPYVTPLVRKLAN
KHGVDLNKIEGTGVGGRIRKQDVLAAAGQGSEPVAAAAPAAAAKDPRANWSTKSVDPAKA
ELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKENKPAFIEKYGANL
TYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNVAIAVDTERGLLTPVIHKAQEL
TLPEIAQAIADLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILGTAA
IQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKNRLEKAKFQDDLNL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcgacgaagacgacaccgttgatgtcggcgaggttatcgccatcatcggtgaggaaggc
gaggctcctgcagcaagcgattccgctgagaagaaggaagagccgaaggcagaggcacaa
gccgaagaagaaaccacaactgaatccaaggaagctcccaagggctccggctcctccacc
gacgtggtcatgccagaactcggcgaatccgtcaccgaaggaacaatcacccagtggctc
aagtctgtcggcgacaccgtcgacgttgacgagccattgctcgaggtttccaccgacaag
gttgacaccgaggttccttccccagtggcaggcaccatcctagaagtcctcttcaacgaa
gacgacaccgttgatgtcggcgaagttatcgtccgcatcggcgaaccaggctccgaacca
gaagccaaggcagaacctgccaaggaagagccaaaggaagaagcaccagccgaagaagaa
cctgctaaggaagcacccaagggctccggctcctccaccgacgtggtcatgccagaactc
ggcgaatccgtcaccgaaggaacaatcacccagtggctcaagtctgtcggcgacaccgtc
gacgttgacgagccattgctcgaggtttccaccgacaaggttgacaccgaggttccttcc
ccagtggcaggcaccatcctagaagtcctcttcaacgaagacgacaccgttgatgtcggc
gaagttatcgtccgcatcggcgaaccaggctccgaaccagaaaccaaggcagaacctgcc
aaggaagagccaaaggaagaagctcccaaggctgaggaagcacctgctaaggaagctgca
aagccagttaataaccagaatgttccttacgtgaccccattggttcgtaagcttgccaac
aagcatggcgttgatctcaataagatcgaaggaactggtgttggcggtcgcatccgtaag
caggacgtccttgccgcagctggtcaaggatctgagccagttgcggcagcagctcctgct
gccgcggctaaggatcctcgcgctaactggtcaaccaagagcgttgaccctgcaaaggcg
gagctcataggcaccaccaagaaggtcaaccgcatccgcgagattacggccaagaagatg
gttgaggcactgcagatttctgcacagctcacgcaccttcaagaggtcgatatgaccaac
gttgcaacgctgcgcaaggaaaataagccggcattcatcgaaaagtatggcgctaacctg
acctatctgccgttctttgttaaggccgtggtcgaggctctggtcctacacccgaacgta
aacgcgtcttacaacgctgcaaccaaggaaatcacctaccactctgacgtcaatgtggcg
atcgcagtggacacagagcgtggcctgcttactcccgtgattcacaaggctcaggaactt
acgctgccagaaatcgcccaggctattgctgatctggctgatcgtgctcgtaacaacaag
ctgaagccaaatgatctctccggcgcaaccttcaccgtaaccaacattggctccgaaggt
gctctggcagatacaccaatcttggttccgccacaggtcggtatcttgggtactgctgca
atccagaagcgccccgtagtgatcactgaaaacggttcggacgccatcgcgattcgccag
atgtgctacatcccgttctcctatgaccaccagatcgtagacggtgctgacgcaggtcgc
ttcaccgcaacgattaagaatcgtttggaaaaggctaagttccaggacgacctcaacctc
tag

DBGET integrated database retrieval system