KEGG   Corynebacterium ulcerans 0102: CULC0102_1697Help
Entry
CULC0102_1697     CDS       T02171                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CULC0102_1697 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC0102_1697 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CULC0102_1697 (thrC)
Enzymes [BR:cue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CULC0102_1697 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1828966..1830534)
Genome map
AA seq 522 aa AA seqDB search
MPGSVASSYDIKIDAISGGSDKKCPSVFFSARAVDASVVAVHYISTRDTSQTPVAFTDIL
LGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALAAEVLKLFVDDIPAADLEAIT
ARAYTTPKFADEEIVPVTKLEDGIYIGHLSEGPTAAFKDMAMQLLGELFEYELRRRKETL
NILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQAQMFGLDDPNIFNIALDGVF
DDCQDVVKAVSSDADFKANNHIGAVNSINWARLMAQVIYYISSWLKVTENNDQKVSFCVP
TGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFKTGEYRVRSAAETHETSSPSMDI
SRASNFERFIFDLLGRDAERCSELFGEQVKAGGFSLADDESFEHAATHYGFASGSSTHAD
RIATIADCYTRRGLMLDPHTADGVKVAREWASQIESPIVCLETALPVKFTDTIVEAVGRG
PEIPERFTGILDAPRHVTDLPNDVAAVKDFILESIARDTAGA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcctggttcagtcgcgagctcatacgatataaaaatcgatgcaattagtgggggtagc
gataagaaatgtccatccgttttcttcagcgctagagccgtcgacgctagtgtagtagcc
gtgcactacatttcgacaagagacacttcccagacccccgtagcgtttactgacatactt
ttgggtggtcttgccccagacggcggtttgtaccttcctgagtattatccgcgtctcgac
gctgccacgttagatacctggcgcggtattctcgcccagcaaggttacgcagcactagcc
gcagaagtgcttaagctctttgtcgacgacatcccggcagcggatctagaagccattact
gcgcgcgcttacacgacgcccaagtttgccgacgaagaaatcgtcccggtgaccaagctc
gaggacggcatttatataggccacctatctgagggaccgaccgctgcattcaaagacatg
gccatgcagcttcttggcgagctctttgaatatgagctacgccggaggaaagagacctta
aacattctgggtgccacctctggcgacacaggatcctctgctgaatacgcgatgcgtggg
cgtgcaggaatccgtgtgttcatgctcacccctaaagaccgcatgacgccattccagcag
gcccagatgtttggtctggatgacccaaatatctttaatatcgcgctagatggcgttttt
gatgattgtcaagacgtggttaaagctgtgtcgtccgacgcggattttaaagcgaacaac
cacattggtgcagtgaactcaattaactgggcccgtttgatggcgcaagtgatctactac
atttcttcgtggctcaaagtaacggagaacaacgatcaaaaagttagtttctgcgttccc
accggaaactttggcgatatctgtgccggacacattgctaagcaaatggggctgccgatc
gacaggctcatcgttgccaccaatgaaaacgatgttcttgatgagttctttaaaaccggt
gagtaccgtgtgcgctctgcagctgagactcatgagacatcctcgccctcgatggatatt
tctagagcgtccaactttgagcggtttatttttgacctgttaggaagagatgccgagcgc
tgctcagaactctttggggaacaagtaaaagctggcggtttttctcttgccgatgacgaa
tcatttgagcacgctgccacgcattatggttttgcgtcgggtagttccacccacgcagac
cgtatagccaccatcgccgattgctatacgcgccggggcctgatgttggatccgcatacc
gctgatggggtgaaagtcgcgcgcgagtgggctagccagattgaaagccccatcgtgtgt
ttggagaccgctctacccgtgaaattcacggataccattgtagaagcagtaggacgcggt
cctgagattccagagcgctttactggaatcttggatgcaccacgccatgtcacagatcta
cctaatgatgtggctgcagtgaaggacttcattctagagagtattgctcgagatactgcg
ggtgcttaa

DBGET integrated database retrieval system