KEGG   Corynebacterium ulcerans 0102: CULC0102_1854Help
Entry
CULC0102_1854     CDS       T02171                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cue00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2007486..2008040
Genome map
AA seq 184 aa AA seqDB search
MRALIIVDVQNDFCPGGALETVKGAIQAQSIAEYTALHGKKYGCIAATKDWHIDPGDHFS
ETPDFIDTWPVHCMAHTEGADFHPLLLNTRFDEVFYKGHYSAAYSGFEGSTADGQLLSTW
LKDRGVREIDIAGIATDYCVQATALDGLREGFQVTVLSSLCAAVNEDNTRAVLRRLTDHG
CVLG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctctcatcattgttgacgtccaaaatgatttttgtccgggcggggcgttagaa
acggtcaagggtgcaattcaagcacaatctattgcagaatacacagcacttcacgggaaa
aaatacggctgcattgcagccaccaaagactggcatatagaccctggcgatcacttttct
gaaaccccagattttattgatacgtggcccgtacattgtatggctcatacagagggcgcc
gattttcatccgctgctcttaaacacgcgctttgacgaggtgttctataaagggcactac
agcgccgcctactcagggttcgagggttccacggcagatgggcaactcttaagcacatgg
ctaaaagaccgtggggtacgcgagattgatatcgcggggatcgctacggattactgtgtt
caggctacggctctcgacggtctacgagaaggcttccaggtaacggtgctctcgagcctg
tgcgccgccgtcaatgaggacaacacccgcgcagttttgcgtaggctcacagaccacggg
tgtgtcctcggttaa

DBGET integrated database retrieval system