KEGG   Corynebacterium ulcerans 0102: CULC0102_1947Help
Entry
CULC0102_1947     CDS       T02171                                 

Gene name
gpx
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00480  Glutathione metabolism
cue00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CULC0102_1947 (gpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CULC0102_1947 (gpx)
Enzymes [BR:cue01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CULC0102_1947 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAM28145
Position
complement(2111366..2111839)
Genome map
AA seq 157 aa AA seqDB search
MTQFFDIPVTLNDATETTMNDWAGHCLLIVNTASKCGLTPQYEALEELYRDYSQRGFFVI
AMPCNQFAEEEPGSNKQIAEFCKREYDVTFPILEKADVNGENAHPLYRFLKGDGPDIEWN
FEKFVVSPEGKVVGRFAPNMEPDDLEIIECLEEHVVL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagttctttgatattccggtgacgcttaacgacgccaccgagacaaccatgaat
gactgggcggggcactgcctacttattgtgaataccgcgtccaagtgtggcctgaccccg
cagtacgaggctctggaagagctgtatcgagactactctcagcgtggcttctttgtgatt
gcaatgccgtgcaaccagtttgctgaggaagaacccggatccaataaacaaatcgcggag
ttctgcaagcgggaatatgacgtgaccttcccgattcttgaaaaggcagacgttaacggt
gagaatgctcatccgctgtaccgattcttaaagggagacggtccagatattgagtggaac
tttgaaaagttcgtggtttctccggaaggaaaagttgtgggccggttcgcgccgaatatg
gaacccgatgatctagagatcatcgaatgtttagaggaacacgtggtgctttaa

DBGET integrated database retrieval system