KEGG   Corynebacterium ulcerans 0102: CULC0102_2162Help
Entry
CULC0102_2162     CDS       T02171                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cue00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cue00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354414..2355541)
Genome map
AA seq 375 aa AA seqDB search
MHIKRLLAAALLGALAACSDAGTDTDPASTEVTTASTTASATQETSAPPSAKTQPNDVRA
QAASLMMVGVSNYDDALSALNQGVGGIFIGSGTDPNLLTAPGRNIEALRKAVGRDFSVSI
DFEGGRVLRHQGILGTFPSPQVMAQTMTPEQVRGMAKTMGDSLFAHGVTVNFAPVADIDA
GLDVVGDRAFSADPTIDAEYAAAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPPL
GDLENIDLVPYSRINVPGAGVMLGHMVVPDLGSPKNGLPSTLNPAAYQLLRTGSYRGGHP
FDGVVYTDDLAMGAVTGIMPVPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGAY
PRAQFEDSVRRVGVL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcacataaaacgacttctcgccgccgccctcctcggtgcgctcgccgcatgcagtgac
gccggaaccgatacggatcccgccagcaccgaggtcactactgcgtccaccactgcgtcc
gcaacgcaggaaaccagtgcgcccccaagcgcaaagacgcagcctaacgacgtccgcgct
caagccgcaagcctcatgatggtgggagtaagtaattacgacgacgccctctctgcctta
aaccaaggtgttggaggcatcttcatagggtcaggtacagatcccaaccttctcaccgcg
ccgggtagaaacatcgaggcattgcgtaaggccgtggggcgcgatttctctgtctccatc
gactttgaaggcgggcgggttctccgacaccaaggaattttagggaccttcccctcaccc
caagtgatggcgcaaaccatgacccctgagcaggttcgaggcatggctaaaacgatgggc
gactcactgttcgcacacggggtgacggtgaactttgcgccagttgcggacatagacgct
ggactagatgtcgtgggcgatcgcgcttttagtgcggaccctactattgatgctgaatat
gcggcagcctttgctcaaggaatgctagacgcaggagttcggccagtgtttaagcatttc
cccggacacggacgcgctagtggtgactcccacacagggcaggtatttaccccgccattg
ggagacctagagaacattgacttggtgccctatagccggattaatgtccccggtgctggc
gtgatgctcgggcacatggtggttcccgatctaggctcgcccaagaatggtcttccctcc
acccttaatccagccgcctaccagctgctgcgtactggttcttatcgcggcggacatcct
ttcgatggtgtggtctataccgacgatcttgccatgggcgcagttacgggaattatgcct
gttccccaggctgtggtggcgtcgttgcaagcaggtgccgatcaagcattgtgggtgacc
actgctggcctcaaagaggctatcgacgccaccgttgcggctgtggaaacgggtgcatat
cccagagcccaatttgaagactctgtgcgcagggttggcgttctttga

DBGET integrated database retrieval system