KEGG   Corynebacterium ulcerans 0102: CULC0102_2217Help
Entry
CULC0102_2217     CDS       T02171                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CULC0102_2217 (deoA)
Enzymes [BR:cue01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CULC0102_2217 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2426111..2427397
Genome map
AA seq 428 aa AA seqDB search
MAEKFDAVDVIRTKRDKGKLSKGQIDWIIDAYTRGVVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEITADHDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAGLGEKVTKGQKLFTLHTDDEDRFDRALESLEPGVKISDEAPAPRT
SVILDRIS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaagttcgacgccgtagacgtcatccgcacaaagcgggataaaggaaagctg
agcaaggggcaaatcgactggatcatcgatgcctacactcgcggtgtcgtcggcgacgac
caaatggccgccctcaacatggcaatattcctcaatggcatggatcgagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgaaaccatgagctttgccagcctctcccgc
cccaccacagacaagcactccaccggcggcgttggcgataaaatcaccctccctctcgca
ccgctcgttgccagctatggcgttgccgtgccacagctctccggaagaggactagggcac
accggcggaaccctggacaaactagaagccatccccggctgggaagccgacatagataac
gcccgcatgatgaagatcctggaagacccaggctgcgtagtatgcgccgcgggagccgga
ctggcaccagcagacaagaagatctatgcgctgcgcgacatcaccgctaccgtcgactgc
atccctttgatcgccagctccatcatgagtaaaaagatcgccgaaggaaccgcgaacctt
gtcctcgacgtcaaggtcggctctggcgcctttatgaaggagcttgatcaggcacgcgag
cttgcccgcaccatggttgatcttggccgcgacgccggaaccaacatggtcgcacttctc
acagacatgtccgtacctctaggtcgcaccatcggcaacgccctggaagttcgcgagtcc
gtagaagtactcgcaggtggcggaccttccgatgtcatagagctcacctgcgcccttgca
acagaaatgcttgaactcgccggcgtccacgatcctgacgtgcatgaagcgcttgccgac
ggccgcgcaatggattcctggaagaagatgatccgtgcacagggcggcgaccccgacgct
gcactccccaccgcacgccacacccacgagatcactgccgaccacgacggctacctcaca
gaaatggatgccctcgcactaggcgtagccagctggcgacttggcgcaggacgtgcccgc
aaggaagatccagtccagcttggcgctggcatcgagattcatgcaggactcggcgagaag
gtaacaaagggccagaagctcttcaccctccacaccgacgatgaagaccgttttgaccgc
gccctagagtctctcgaacccggcgtaaagattagcgatgaggccccggccccacgcact
tcggtcatcctcgaccgcatcagctag

DBGET integrated database retrieval system