KEGG   Corynebacterium ulcerans 0102: CULC0102_2297Help
Entry
CULC0102_2297     CDS       T02171                                 

Gene name
nagK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00010  Glycolysis / Gluconeogenesis
cue00052  Galactose metabolism
cue00500  Starch and sucrose metabolism
cue00520  Amino sugar and nucleotide sugar metabolism
cue00521  Streptomycin biosynthesis
cue01100  Metabolic pathways
cue01110  Biosynthesis of secondary metabolites
cue01120  Microbial metabolism in diverse environments
cue01130  Biosynthesis of antibiotics
cue01200  Carbon metabolism
Module
cue_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC0102_2297 (nagK)
   00052 Galactose metabolism
    CULC0102_2297 (nagK)
   00500 Starch and sucrose metabolism
    CULC0102_2297 (nagK)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC0102_2297 (nagK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CULC0102_2297 (nagK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CULC0102_2297 (nagK)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CULC0102_2297 (nagK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: BAM28495
Position
complement(2515229..2516143)
Genome map
AA seq 304 aa AA seqDB search
MIDKSGETQAAVRIGVDIGGTKIAAGIVADSDPTTVIEYRRRSTPTTNVIDEVAGIIQEL
IDASPVAVSTIGIGAPGVIDPIAGEVVSSGPTMQGWAGTKIADTLRGQFPLPIAVHNDVR
VMGLGESVYGAGHDFDNVLFVSLGTGVGGALVRDGELVASPHFTAGELRCLWGRLPDGSA
ALLESFASGPGLASCYNAHAENPAVDLHEIMSRYHAGEEYARDVIEEHLFACGVAIGGFI
SAIDVDAVIVGGGVGTIGDAIINPFARGIRDGAIPPINEVPVIQAQLGTHAPIVGAAYLG
KTQG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaaaagcggtgaaacgcaagcggccgtgcgtatcggcgtggacatcggcggg
accaagatagcggctggcattgttgcagattcggaccccactaccgttattgagtaccgc
cgccgatctacccctacaacaaacgtgatagacgaggtcgcaggcattattcaagagctt
atcgacgcctcccccgtcgcagtgtccaccatagggatcggtgcgccaggggtcattgat
cccatagcgggtgaggtggtgtcctcgggaccgaccatgcagggttgggcggggactaag
atcgcagatactttgaggggacaatttccgcttcccattgcggtgcataacgacgtccgc
gttatggggttgggtgaatccgtctacggtgctggtcacgactttgacaacgttttgttt
gtcagtttgggtactggtgtcggaggggcgctcgtgcgtgatggtgagcttgttgcctcg
ccgcattttaccgccggagagctgcgctgcctgtggggtcggctcccggatggttccgca
gccctattagagtcttttgcttccggacctggacttgcatcctgttataacgcacatgcg
gagaacccagctgtagacctccacgagatcatgtctcggtaccatgccggcgaggaatac
gcacgggatgtgattgaggaacacctctttgcctgcggggttgcgataggcgggtttatc
agcgccattgatgtggatgcggtgatcgttggcggcggcgtgggcactattggcgatgcc
atcatcaatccctttgcccgtgggatcagagacggcgctattccaccgatcaatgaggtg
ccggttatccaggcgcaattaggtactcatgctcccatcgtgggcgccgcatacctgggt
aagacccagggctga

DBGET integrated database retrieval system