KEGG   Corynebacterium ulcerans 0102: CULC0102_2327Help
Entry
CULC0102_2327     CDS       T02171                                 

Gene name
trpC1
Definition
indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cue01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cue00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2551583..2553073
Genome map
AA seq 496 aa AA seqDB search
MHNNAASMPTVLEEIVHARRSHLQEIRARIAHVDPLRLPRSTKSLFQALGGSVSGGVAPR
RQAHSDTSTRAPHFIMECKSASPSLGDIRADYSPGDIARIYSRYASAISVLCEPDKFNGD
YDHLATVAASTHLPVLCKDFIIDPVQVHAARYFGADAILLMLSVLDDATYISLSHEAERL
SLDVLTEVINEEEVKRAIRLGAKIFGVNHRNLHDLSIDLSRSSQLEALIPATAILVSESG
IQTNETVRQLAGHSDAFLVGSQLTGCIDVDSAARSLVFGTNKVCGLTTASGAQTARAVGA
THGGLIFEESSPRNVSRETAQKIIAAEPHLHYVAVSRRTQDWTEILLPGIKTLQIHTPYQ
GSIAGERELLNKARAELRKAGREDIAIWRAVSMTAPEGPDIAVALMDDVDMILLDTGAGG
TGTPFPWEKIPQGVTPKAILAGGLNPDNLPEALVRGCAGLDLNSGVEYPANAGIWAGLKD
SGALRQAFSTIREFHY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacaataatgcagcgtccatgcccacagtcttagaagaaattgttcacgcccgccga
tcacatcttcaagagattcgtgcccgcattgcacatgtagatcctctccggttgccgcgg
tccacaaaatctcttttccaggcgcttggtggctctgtgagcgggggagtggcgccgcgt
cgtcaagcacattctgacacctctacaagggcgccgcacttcattatggagtgcaaatcc
gcatcaccgtcattaggggacattcgagccgattattccccaggagacattgcacggatt
tactctcgctacgcttccgcgatttccgttctttgcgagcccgacaaatttaacggcgat
tacgatcacctggccaccgttgcagcttccacgcatctgccggttctatgcaaggacttc
atcatcgatcccgtgcaggtgcacgctgcacgctactttggcgcggatgcgatcctactc
atgcttagcgtgcttgacgacgccacctatatctcactttcccatgaagccgaacgcctc
agcctggacgtcctcaccgaagtaatcaacgaggaggaggtaaagagagccattcgcctt
ggcgcaaagatttttggtgtcaatcaccgcaacctacacgacctcagtatcgacctttcc
cgttcctcacaactagaagccctcatcccggccaccgctatactcgtgtcagaatccggc
atccaaacaaacgagactgtccgccagttggcaggccattccgacgccttccttgtcggc
tcacaactcaccggctgcatcgacgttgactccgccgcacgttcactcgttttcgggacg
aacaaggtgtgtggactcaccaccgcttccggcgcccaaactgcacgcgcagtcggcgca
acgcatgggggattgatatttgaagaatccagccctcgcaatgtttcacgtgaaactgcc
caaaaaatcattgcggcagagccacatctacactacgttgcggtgagtagacgcactcaa
gactggacggaaatactccttccgggtattaaaaccctccagatccacaccccatatcaa
gggtccatcgcgggggagagagagcttctcaacaaagcccgcgcagaactccgcaaagcg
ggaagagaagacattgccatctggcgagccgtatccatgacagcgccggaaggtcctgat
attgctgtggcactcatggatgacgtagatatgatccttctcgacaccggtgccggcggc
accggaacaccctttccttgggaaaagatccctcagggagtgacaccaaaggcaatcctg
gccgggggtcttaatcctgacaatcttcccgaagcattagtaagggggtgcgccggtcta
gaccttaattccggcgtcgaatacccagccaacgccgggatctgggcgggattaaaagat
tcaggggcactacgccaagctttctccaccatccgagagtttcattattaa

DBGET integrated database retrieval system