KEGG   Corynebacterium ulcerans 0102: CULC0102_2328Help
Entry
CULC0102_2328     CDS       T02171                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CULC0102_2328 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC0102_2328 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CULC0102_2328 (trpB)
Enzymes [BR:cue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CULC0102_2328 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2553497..2554747
Genome map
AA seq 416 aa AA seqDB search
MTLSQNSTDQHTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPQFREELAGYLKD
YLGRPTPLTECSKLPLAGKGRGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACALLDLECVIYMGAKDVERQQPNVYRMELMGATVVPVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMIERTGGLPDVV
VACVGGGSNAIGMFADFIDDPSVELVGAEPGGEGLSSGKHGATINNGQVGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSKSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRATLAEEEGKNITIVVSLSGRGDKDIDHIRKTLAANPALALKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctcccagaactccaccgatcagcacacactccttcccgcatatttcggggaa
ttcggcggacaattcgttcccgagtcactcctgccagcactcgaccaactcgaaaaagcg
tttgttgaggcacaagaagatccacaattccgagaggagctcgcgggctatctcaaggat
tatttggggaggcccacccccttaaccgaatgttccaagctacctctggctggaaagggt
aggggatacgcgcgcatcttcctcaaacgcgaagacctagtccatggcggagcacataag
acaaaccaagtgatcggccaggctctcctggctaagcggatgggcaaaaagcgcatcatt
gcagaaaccggtgcaggacagcacggaaccgcaaccgcccttgcgtgtgccctcttagac
ctcgaatgcgtcatctacatgggagcaaaagatgtagaacgccaacaacccaacgtgtat
cgcatggaactcatgggtgccacagtggtacccgtagactcaggatcagggacgctcaaa
gacgcggtcaatgaggcgcttcgggattggactgcaaccttccacgaatctcattaccta
ctcggcacggcagcaggcccccacccattcccgacgatcgttcgagaattccaccgtgtg
atttccgaagaggcaaaagcacaaatgattgaacgcacgggaggcctccccgacgttgtg
gttgcttgtgtgggcggaggctccaatgcaattggcatgtttgcagatttcattgacgat
ccttccgtagagctcgtcggagcggaacccggcggtgaaggcctatcatccggcaagcac
ggagcaaccatcaacaacggacaagtcggtatcctgcacggcgctaaaagctatttgatg
cgaaactctgatggccaagtggaagagtcctattccatttccgccggactagattacccc
ggggtcgggccacaacacgcgcacctatcaaagtctggacgagccacctatgtagccatc
acggacgccgaggctcttgaagccttccaattactctcccgtgaagagggaatcatccca
gcactggaatcaagccatgcgcttgcgtatgcactgaagcgagccaccctcgcagaagaa
gaaggaaaaaatatcaccatagtggtctccctttcaggacgtggtgataaagacatcgat
cacattcgcaaaactctcgccgccaaccccgcgcttgccctcaaggactaa

DBGET integrated database retrieval system