KEGG   Corynebacterium ulcerans 0102: CULC0102_2329Help
Entry
CULC0102_2329     CDS       T02171                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CULC0102_2329 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC0102_2329 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CULC0102_2329 (trpA)
Enzymes [BR:cue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CULC0102_2329 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2554750..2555589
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLAIIRTAVKAGADALEIGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLSLIAQTRSEFPDLPIGLLIYGNVPFTRGLDTFYQEFAT
AGADSILLPDVPVREGAPFITAAQQAGIAPIFIAPAQASEDTLRDVAAHSEGYIYAISRD
GVTGTERESSTSGLSDVVANITAFGGAPTLLGFGISTPQHVRDAMAAGARGVITGSAITA
IIERHCVGTHPQPATIDDMPALQSEISAFIAEMKEATRK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaaccttttcacccgactagagcaatccaatgaaggagcctttgtt
cctttcatcatgctcggcgacccttctcccgaagcatcacttgcaatcattcgtaccgct
gtcaaagccggcgcagatgcacttgagattggcgttcccttctcagacccggtggccgac
ggcccaaccatccaacgatctcatctccgcgccttggataatggagcaaccgtcgattcc
tctttgtcgctcattgctcagactcgttcagaatttccagacctgcccatcggcctcctg
atctacggcaacgtccccttcacccgcggactagacaccttctatcaagaattcgccacc
gccggcgccgattctattttgcttcccgacgtcccagtacgggaaggggcacctttcatc
acagcagcacaacaggcagggatcgcacctattttcattgcacccgcacaggcatcggaa
gataccctccgagacgtggcagcacattctgaaggctacatctacgcaatttctcgcgat
ggggtcaccggcacagaacgggaatcctccactagcggactcagtgacgtagtagcaaac
atcacggcattcggcggtgcccctacgcttctcgggttcggaatttccactccccagcac
gttcgcgacgcgatggcggccggggcaaggggagtaatcaccggatccgccatcacagca
atcattgaacgccactgtgttggtacacaccctcagcccgcaacaatcgatgacatgccc
gcgttgcaatcggaaatttccgcttttatcgctgagatgaaagaagcaactcgcaagtaa

DBGET integrated database retrieval system