KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00139Help
Entry
CULC22_00139      CDS       T01549                                 

Gene name
glpK2
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CULC22_00139 (glpK2)
Enzymes [BR:cul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CULC22_00139 (glpK2)
Exosome [BR:cul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CULC22_00139 (glpK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(143193..144146)
Genome map
AA seq 317 aa AA seqDB search
MYIAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEHDAIEIWDNTRRAVGTA
LADSDLSAKDIAALGITNQRETTVVWDKKTGEPVYNAIVWQDTRTTTICKELAGDEGADR
WYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTIDTWLLWNLTGGADGDDGT
PALHATDVTNASRTLLMDIEKLEWDKDLCDAMGIPMDMLPEIRPSVGDFHQVRERGSLSG
VPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTGTTPKWSENGLLTTVCLPNRR
PKNQSTHWKVRSQSEDR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagcagccatcgatcaaggcactacttcaacccgctgcatcatttttgaccac
gacggcaaccaagtctccgtcggtcaatacgaacatgagcaaatcttcccacaaaaaggc
tgggtggagcacgatgccatcgaaatctgggacaatacccgccgcgcagtaggcaccgcc
ctggccgacagtgatctctccgccaaggacatagccgccttaggcattaccaaccagcgc
gaaaccacagtagtttgggacaaaaagaccggcgagcccgtatacaacgccatcgtgtgg
caggacactcgcaccactacaatctgcaaagagctcgctggcgacgaaggcgccgaccgc
tggtaccgcaagaccggcctcctcatcaattcctatcccgccggacccaaaatcaaatgg
atcctagataacgtcgacggcgcccgcgaacgcgcagaagcaggcgaactgctctttggc
accatcgacacatggctcctgtggaatctcaccggtggagccgacggcgatgacggaacg
ccagcattgcacgcaaccgacgtcaccaatgcttcccgcactctcctcatggacatcgaa
aaacttgagtgggacaaagacctctgcgacgccatgggcatccccatggacatgctccct
gagatacgcccctcggtcggcgatttccatcaggtccgtgaacgcggatctctctccggg
gttcccatccgttcgatgcttggcgaccagcaagccgccatgttcggccaaggttgcttc
cgcccgggcgaagcaaaaaacacttacggcacaggcctcttcctgcttctcaacacagga
accactcccaagtggtcagaaaacggcctgctcaccacggtttgtttaccaaatcgaagg
ccaaaaaaccagtctacgcactggaaggttcggtcgcagtcggaggatcgctag

DBGET integrated database retrieval system