KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00305Help
Entry
CULC22_00305      CDS       T01549                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC22_00305 (gpmA)
   01230 Biosynthesis of amino acids
    CULC22_00305 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_00305 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CULC22_00305 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC22_00305 (gpmA)
Enzymes [BR:cul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CULC22_00305 (gpmA)
Exosome [BR:cul04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CULC22_00305 (gpmA)
  Exosomal proteins of melanoma cells
   CULC22_00305 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338898..339644
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLPQVPRTECLKDVVDRFVPYFEEEILPRAQKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQDGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgtcacggacaaagcgagtggaacgcctccaac
caatttactggttgggtggacgttaacctcaccgagcaaggcgaggccgaggccaagcgt
ggcggcgagatgctgaagcaacaggatgtcctgccaactgttgtgtacacatcacttctt
cgtcgagcaatccgcaccgccaacatcgcgcttaacgcagcagatcgccattggatccct
gtcgtgcgcgactggcgtctcaacgagcgtcactatggtgcgctgcagggcctgaacaag
gctgagaccaaggataagtacggcgcagatcagttcatggaatggcgtcgttcctacgga
actcctcctccagagctggaagattccagcgagttctcccaggccaacgatcctcgctat
gccgatcttcctcaggtgccacgcacagaatgcctgaaagacgtcgtggaccgttttgtt
ccttattttgaagaggaaatcctgccgcgggcacagaagggcgagactgttcttattgca
gcgcatggcaattctttgcgtgcattagtcaaacatcttgacaatatctcggatgcagat
attgccgagctcaatattcctactggaattccgctggtatacgagcttgaccaggacgga
aaggttcttaacccgggcggcacctaccttgatccagaggcagcggcagcaggtgctgcg
gcagttgccgcacaaggcggcaaataa

DBGET integrated database retrieval system