KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00321Help
Entry
CULC22_00321      CDS       T01549                                 

Gene name
hemD
Definition
(GenBank) uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00860  Porphyrin and chlorophyll metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC22_00321 (hemD)
Enzymes [BR:cul01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CULC22_00321 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CULC22_00321 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEG83039
Position
352256..353944
Genome map
AA seq 562 aa AA seqDB search
MSLTPQPNPVTPLPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFAVVDAEVLPGVRSVVA
RELDVPADKIQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEITEVDDEVPVAEIVDKL
KELLTTGEDVIRLVQGNPLSCDRTLEEISAVTQAGLEFHVVPGMSLPATVPAFAGIALGS
SYTETDVTGEDVDWEQLASAPQPLVLQATKDDLPTIAAELKARGLAASTPVTVTAHGTTR
LQRSFDVSLGALSKLDGDLAGTLVVTLGKAVDERTKYSWWENRSLFGWRVLVPRAKEQAG
PMSTLLASQGAIPQEVPTISVEPPRNPAQMEKAIKGIVEGRYQWVIFTSVNAVKAVREKI
GSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPRNQQNAAGLVSVFPEYVEDLDP
VGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGGFDAVCFT
SASTVKNLVGIAGKPHQRTIIACIGPMAEAAAKELGLRVDVVPEVADVPHLVNSLAAHVA
QLRAAGQLPPPRKKRRARKNRE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcactccgcagcccaatccggttacccctttgccggagggaaaagtgatcttc
gtaggagcaggaccaggaaaccctgatctgctcaccgttcgcgcccgcgaagttctcagc
cataccgcttttgccgtagtagacgcagaagtactcccgggggttcgctctgtagtcgca
cgtgaactggatgttccggccgataagattcaggcggctgaggaagaatacgagcgcctc
tgcgcagaggcgaaagaggccggcgctcgccgtaagccgcagcgtccagatgccccgacc
gcagctgagatcacggaggtggacgatgaggttccggtggcggagatcgtcgacaagctt
aaggagcttttgactacgggcgaggacgttatccgccttgtacaggggaaccctttgtct
tgcgaccgtactttggaagaaatatctgcggtcactcaagctggactggaattccatgtt
gttccaggtatgtccttgccagcgaccgttcccgcttttgccggcatcgcactggggtct
tcttatacggaaactgatgtgaccggcgaagacgtggattgggaacagctggcgtcagca
cctcaaccgctggtcttgcaggcaaccaaagatgacctgcccacgatagcggcagagctc
aaggcccgtggattggcggcatcgacaccggtgacggtgactgctcacggcacgacacgt
ttgcagcgaagctttgacgtcagcttgggtgctctgagcaagttggatggggatctcgct
ggcaccctcgtggtcaccttaggcaaagccgtggacgagcgcaccaaatattcctggtgg
gagaatcgctcgctctttggctggcgagtcctggtgcctcgcgctaaagaacaagccggc
cccatgagcacattgttggcttcgcagggggcaattccgcaagaagtccccacaatttcc
gtagaaccgccgcgcaaccccgcgcaaatggagaaagccattaagggaatcgtcgaggga
cgctaccagtgggtgatctttaccagcgttaacgcggtgaaagctgtgcgagaaaagatc
ggttctttcggcctcgatgcccgcgcctttgccggcgtacgcatcggtgcggtgggaaca
aaaaccgctaaggctatccgcgagctggggattactcccgagctgttgccgcctaggaat
cagcaaaatgctgcaggcttagtgtcggtgttcccggaatatgtggaagaccttgaccca
gtgggaagagtcctcttgcctcgcgcagatattgcaacagacgtcctggtagaaggccta
gagggcttgggctgggaagtcgatgatgtggttgcgtatcgcacggtacgcgctgcgccg
ccgagcgcggaagtgcgcgacatgattaaaagtggcggttttgatgcagtgtgctttacc
tctgcgtcgacggtgaaaaacctggtgggcatcgccgggaaaccgcatcagcgcacgatc
atcgcatgcatcggtcctatggcagaagctgcggcaaaagaattaggactgcgagtggat
gtggtccctgaggtggcggatgtcccacacctggtgaacagccttgccgctcacgtggca
caactccgtgcagctggtcagctaccaccgcctaggaagaaacgacgcgcccggaaaaat
cgcgagtaa

DBGET integrated database retrieval system