KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00322Help
Entry
CULC22_00322      CDS       T01549                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cul00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353992..354999
Genome map
AA seq 335 aa AA seqDB search
MSNEDLHLIRRPRRLRNTPVMRELVAETTLRPADLILPMFVADGITEPREISSMPGVYQH
TIPSLIEAVREAISVGIKCVDLFGVPLDADKDAQGSQSWAPEGILNRATTALRQEFGNSV
IIMADTCLDEFTDHGHCGVLSTDRFGEVIVDNDATIPLYQKMAVAQAEAGAHMVSPSGMM
DGQIAAIREALDAHGFQDVAIMAYSAKYASAFYGPFREAVGSSLEGDRRTYQQDPANFRE
SLVEVDLDIEEGADFVMVKPAMPYLDVLAEVAATSVVPVAAYQVSGEYAMLHAAARNNWL
DLERVMMESLISIKRAGADQILTYFAVDAAKKLQH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaagatctccatctgattcgtcgtccacgcaggctccgaaacacgccggtg
atgcgcgaattagtggcagagacgacgcttcgtcctgctgacctgattcttcctatgttt
gtcgcagacggaataactgagcctcgtgagatttcctctatgcccggtgtctaccagcac
actattccttccttaatcgaggccgtcagggaagccatttccgtgggaattaagtgcgtc
gatctcttcggcgttcctctcgacgcagacaaagatgcgcagggatctcaatcgtgggcg
ccagagggaatcctcaaccgagccaccaccgcgctacgccaggagtttggtaacagcgtc
atcatcatggcagatacctgccttgatgagttcactgatcacggccactgtggcgtgctg
agcaccgatcgctttggcgaggtgatcgtggataatgacgcgaccattccgctttatcaa
aagatggcggtggcgcaggctgaggcaggcgcgcacatggtaagtccctccggcatgatg
gatgggcagattgcggcaatccgtgaagctctcgacgctcatgggttccaggacgtggcc
atcatggcgtactccgccaagtatgcgtcggctttctacgggccgtttcgcgaggcagtg
gggtcgtctttggaaggcgaccgcagaacctatcagcaggaccctgctaacttccgggaa
tcgctagtggaagtcgatctggatattgaagagggtgcggactttgttatggtcaaacca
gcaatgccttaccttgacgtgttagcagaggtggccgccacgtcggtcgtaccagttgcc
gcttatcaagtatcaggcgaatacgccatgctgcatgcggccgcccgtaataactggctc
gaccttgaacgtgtgatgatggaatcattgatttctatcaaacgcgctggcgcagaccag
attcttacttactttgccgtcgatgcggcgaaaaaactacagcactag

DBGET integrated database retrieval system