KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00326Help
Entry
CULC22_00326      CDS       T01549                                 

Gene name
hemY
Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00860  Porphyrin and chlorophyll metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC22_00326 (hemY)
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CULC22_00326 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CULC22_00326 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 FAD_binding_2 DAO HI0933_like NAD_binding_9 Pyr_redox Pyr_redox_2 GIDA Mqo
Motif
Other DBs
NCBI-ProteinID: AEG83044
Position
359459..360844
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLDPHVEVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLA
FREDTTEFFKELGLGESLRSPSGLPSLLYVGGSLHGMPSNTIMGIPGTSEGLGDLVSEET
LKRIDEEKDAGSIEWPQEVSLGALLRERLGDDVVDHVVSALQGGVYSSTSDDLSVRATVP
QLARAFDRLKEEGKPVTITGAVQRLLSERETRNKARGYTPSVFASFAGGYAEMYETLAEL
SEAKIHIDAFITAIDKTAEGFTLKGAEGVFDKVLLTVPAPTAALLLKNLAPEAAQQLKTI
KLASSAVVGMKFDHSEGLPENSGILVATDAHDVKAKAFTFSSKKWPHLGERGGALVRASF
GRFGDDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLETV
AAIKDALAEVQGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccattatcggtgcagggttagcgggactaacggctgcttatgagatccat
aaactcgatcctcacgtggaagtagaggtgtttgaggcgacagatcggatcggcggcaaa
ctgtttacggttccgtttgcgtctggccccaccgatatgggcgcagaagcgtacttagct
tttagggaagacactaccgagttctttaaagagctaggactcggtgagagcttgcgctcg
ccctcgggattaccttctttgttgtacgtgggaggaagcctccacgggatgccttctaac
acgatcatgggtattcccggtacaagtgagggactgggggacttggtgagcgaggaaacc
ctcaaacgcattgatgaggagaaagatgcgggctcgattgagtggcctcaagaagtaagc
ctgggggcactcctgcgggaacgcttgggtgatgacgttgtggatcacgtggtatcggcg
ctgcaaggtggcgtctattcttccacctcagatgacctaagcgtgcgagctacggtaccc
cagctagcacgggcctttgaccggctcaaagaagaggggaagcccgtaaccatcacaggt
gctgtccagcgccttctttctgaacgagagacccgcaacaaagcgcggggatatactcct
agcgtcttcgcgtctttcgcgggcggctatgcggagatgtatgaaacccttgctgagctc
agtgaggccaagattcacatcgatgcctttatcaccgcaatcgataagaccgctgaagga
ttcactctcaaaggcgctgaaggtgtctttgacaaggtgctgttgacggtgccagcgccc
actgctgcactgctgctgaaaaaccttgcgccggaggccgcgcagcaacttaaaaccatc
aagttggcaagctctgccgtggtcggaatgaaatttgatcattccgaaggcctccccgag
aattcagggatccttgttgccaccgatgctcacgatgtgaaagcaaaggcctttaccttc
tcctccaagaaatggcctcatcttggcgagcgcggcggcgctttagtccgagcctctttt
ggtcggtttggcgatgacgccatcgcacgcgcagacgaggatgagcttgtcgacgcagcc
ctcgacgatctgcagacgattacgggattcgacggacgcgccgcaggtttatcggagatc
tttgtccaacgctggttcggtggcttgccggtgtatgggccagggcacctggaaacggtg
gctgcaatcaaggacgctcttgctgaggtccagggcatcgacgctaccggcgcatgggcc
gatggcgtcggcgttcctgcagtgatcgacgcagcgaaggctgcggccaaacgcgcgctt
gcctaa

DBGET integrated database retrieval system