KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00661Help
Entry
CULC22_00661      CDS       T01549                                 

Definition
hypothetical protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CULC22_00661
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CULC22_00661
   00650 Butanoate metabolism
    CULC22_00661
  Lipid metabolism
   00071 Fatty acid degradation
    CULC22_00661
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CULC22_00661
   00310 Lysine degradation
    CULC22_00661
   00360 Phenylalanine metabolism
    CULC22_00661
   00380 Tryptophan metabolism
    CULC22_00661
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CULC22_00661
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CULC22_00661
   00281 Geraniol degradation
    CULC22_00661
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CULC22_00661
   00627 Aminobenzoate degradation
    CULC22_00661
   00930 Caprolactam degradation
    CULC22_00661
Enzymes [BR:cul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CULC22_00661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718994..719827
Genome map
AA seq 277 aa AA seqDB search
MGLLEHAWEGGASRALGGVETVKVSSDGFVRHIVIDRDERRNALSRDMCLAIAHAVAEAS
AAAVDNASVRAVVISGVGRAFCAGADLGSSVEERGSDGAVYGSDFHDALFAMLHSIIQAE
VPVIANVQGPAVGAGMQLALACDLRVVGESAWFKIPAVSLGFALDGWTIGRAQKLCGGAF
ARNLLLAGATLTTDAALASGFAVIRGDHAAAVAFAHEMAGLAPLAVRQLKGALNYGETDY
GLDEQSQVLFSRCWSSEDMREARQARSEKRVPQFKGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggattgcttgaacatgcttgggagggtggtgcctcgcgggccctgggtggggtagaa
acagtcaaggtatcgtctgatggctttgtgcggcacatagttatagatagggatgagcgt
cgaaacgctctttcacgtgacatgtgcttagccattgcacatgcggttgctgaggcatct
gctgcggccgtcgataatgcgtcggtgcgtgcggtcgtgattagtggggtgggtcgggcc
ttttgtgcaggtgcagatcttggttcttctgtggaggagcgaggctcggatggtgcagtg
tacggctccgattttcatgatgcgctctttgctatgctgcattcgattattcaggcggag
gtgccggtaatcgccaacgtgcaggggcctgcggtgggggccggaatgcagcttgcattg
gcgtgtgacctccgtgttgttggggaatcggcctggtttaaaattccagccgtgtctttg
ggctttgcgcttgacgggtggacgataggacgtgctcaaaagctctgtggaggtgccttt
gctaggaacctactccttgccggtgccaccttgaccacggatgcagccctggctagcggc
tttgccgtaattcggggtgatcatgctgcagcggttgcttttgcacatgagatggcgggt
ttggcgcctcttgccgtgcgtcagctcaagggggcgcttaactatggtgagactgattat
gggttagatgagcaatcgcaagtgttattttctcggtgctggtccagtgaggatatgagg
gaggcgcggcaagcgcggtcggaaaagcgagtgccgcagtttaaggggcgataa

DBGET integrated database retrieval system