KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00689Help
Entry
CULC22_00689      CDS       T01549                                 

Gene name
cysQ
Definition
inositol-1-monophosphatase family protein (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cul00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745357..746151)
Genome map
AA seq 264 aa AA seqDB search
MRNARAPLNFRVMTAHFDDATLTKRLAQGTGEILKGVRNVGLLRGRELGDAGDDLAQNWI
ARVLEQHRPDDGFLSEEAADNPERLGKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGI
PTHAAVNLPDLGVVFHTSEVRAVRGPYAKKIAVSHNRPPAVATHVAEKLGFTAEPLGSAG
AKAMHVLLGDYDAYIHAGGQYEWDSAAPVGVSLAAGLHCSRLDGSPLTYNNKDTYLPDVL
VCRPELADDILSMAAAFREENGSY
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaacgcccgcgctccactaaactttagagtcatgactgctcactttgacgacgcg
accctaaccaagcgacttgcccagggaacgggcgaaatactcaaaggggtaagaaacgta
ggtcttttgcgcggacgtgaactaggcgacgcaggagacgatctggcacaaaactggatt
gcgcgtgtgctggaacagcaccgtcccgatgatggattcctttccgaagaagctgcagat
aacccagagcgcctaggcaaagatcgcgtgtggatcatcgatccgctcgatggaaccaaa
gaatttgctacggggcgtcaggactgggctgtgcacatcgctttggtggaaaacggcata
ccaacccacgctgcagttaacctccccgacttgggagtggtgttccacacgtctgaggtt
cgcgcggtgcgcggcccctacgcaaagaagatcgcagtctcgcacaaccgtcctcctgct
gtagccacccacgtcgctgaaaaactaggtttcaccgccgagccgctcggctctgcaggt
gcaaaagccatgcacgtgcttcttggcgactacgacgcctacattcatgccggtggccag
tacgaatgggactctgcggcccccgttggagtcagccttgctgcaggactgcactgctca
cgtctcgacggctcccccttgacctacaacaacaaggacacctacctgccggatgttctc
gtctgccgccccgagcttgccgacgacatcctctccatggcagccgccttccgcgaggaa
aacggctcgtactag

DBGET integrated database retrieval system