KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00723Help
Entry
CULC22_00723      CDS       T01549                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00040  Pentose and glucuronate interconversions
cul00052  Galactose metabolism
cul00500  Starch and sucrose metabolism
cul00520  Amino sugar and nucleotide sugar metabolism
cul01100  Metabolic pathways
cul01130  Biosynthesis of antibiotics
Module
cul_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CULC22_00723 (galU)
   00052 Galactose metabolism
    CULC22_00723 (galU)
   00500 Starch and sucrose metabolism
    CULC22_00723 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC22_00723 (galU)
Enzymes [BR:cul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CULC22_00723 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEG83436
Position
780293..781354
Genome map
AA seq 353 aa AA seqDB search
MGYMLAQRRREAIRFWQNSENAKKLLYLRWRNWGELSAGCTLVCMKQPQEAQDSTRAAVK
TVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATRLAVITAPNKQEVM
EHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLGLGHAVGLAETVLDPEE
DAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVYNYGVFEIDESTYEGPY
HVKKVKGMVEKPSVDEAPSNFVATGRYLLDRAIFDALRRITPGAGGELQLTDAIDLLIDE
GHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPVYGPHLKKALRKILEEHGA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggatacatgctagcgcagaggcgtcgagaagctatacgcttttggcaaaacagtgag
aatgcaaagaaacttctttatctcaggtggcggaactggggagaactaagcgccggatgt
actcttgtctgcatgaagcagcctcaagaagctcaagacagtacgcgcgccgcggtaaag
actgtcatcgttcctgctgctggcatgggaacgagattccttccggccacaaaaacggtt
cctaaagagctgttgccagtggtggatactccaggcattgaactgattgcagaagaagca
gctcagttgggtgcgactcgactcgcagtgattacagctcctaataaacaggaagttatg
gagcactttaagcgattcccagtgcttgaagagaccctgcaaagtcgagggaaaacggaa
caatatgagaaagtggtccacgcctctgaacttattgccccggtatctgtagtgcaggaa
aaaccgcttggcctcgggcacgcagtcggtttggcggaaacagttcttgatccggaagaa
gacgccgtagctgtcatgcttcccgatgacctcgtgctcccgcgtggcgttgtggaaaag
atggttgaggtgcgtgaacagctaggcggatctgtgctgtgcgcctttgaagttccagag
gaagaagtctataactacggtgtttttgagattgatgagagcacatacgagggtccttat
cacgtcaaaaaagtcaaaggaatggtggagaagccttctgtagatgaagctccctcaaat
tttgtagcgactggtcgctatctgctggaccgggctattttcgacgccctacgcaggatt
acgccgggcgctggcggtgaattgcagctcacggatgccatcgatttgcttatcgacgaa
ggccatcccgtacacatcctcgtgcacgatggaaagcgacatgaccttggtaatcctggg
ggatatataccggctgtcgttgactttgggttgagcgacccagtgtatggcccccactta
aaaaaggctctccgaaagatcctggaagaacacggcgcctaa

DBGET integrated database retrieval system