KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01220Help
Entry
CULC22_01220      CDS       T01549                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC22_01220 (tpi)
   01230 Biosynthesis of amino acids
    CULC22_01220 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_01220 (tpi)
   00051 Fructose and mannose metabolism
    CULC22_01220 (tpi)
   00562 Inositol phosphate metabolism
    CULC22_01220 (tpi)
Enzymes [BR:cul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CULC22_01220 (tpi)
Exosome [BR:cul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CULC22_01220 (tpi)
  Exosomal proteins of bladder cancer cells
   CULC22_01220 (tpi)
  Exosomal proteins of melanoma cells
   CULC22_01220 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1348640..1349419)
Genome map
AA seq 259 aa AA seqDB search
MERTPLIAGNWKMNLDHLKAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTVVDGD
KLQITYGAQDVSEHESGAYTGEISADMLAKLGCTWVVVGHSERREYHGESSKLVAAKAKA
ALGKGISPIVCVGEPLEIREAGTHVDFVVEQTRESLAGLTEAELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLVKELANEEIAEGVRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtacgccgctcatcgctggtaactggaagatgaacttagaccacttgaaagct
gtggcaacagttcagaagctagcctttgcacttcctaaggagtactacgagaaggtcgat
gttgcagttaccgtaccttttacggatctgcggtctgttcagactgtagttgatggcgat
aagcttcagatcacctacggtgcccaagacgtatcagagcatgaatcaggtgcttatacc
ggcgaaatctctgcagatatgctcgcaaagctcggttgcacatgggttgtcgttggacac
tcggagcgtcgtgaataccatggcgagtcctcgaaacttgttgctgcgaaggctaaagca
gcgctgggcaaaggcataagcccgatcgtttgcgtcggtgagcctttggagatccgggaa
gctggcactcacgtagattttgtcgtcgagcaaacccgtgaatcacttgctggtctgact
gaagccgaactagctaagaccgttattgcttatgagccggtgtgggcaattggcactggc
aaggtcgcttctgcggctgatgctcaagaagtatgtaaagcgatccgtggtttagttaaa
gaacttgcaaatgaggaaatcgctgaaggcgttcgtattctttacggtggctctgtaaag
gaagaaacggtcgcagaaatagtcggacagcccgacgtagacggtggtcttgttggtggc
gcttctctcgacggtgaggcatttgccaaacttgctgctaacgcagcgactggtctttag

DBGET integrated database retrieval system