KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01241Help
Entry
CULC22_01241      CDS       T01549                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00230  Purine metabolism
cul01100  Metabolic pathways
Module
cul_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CULC22_01241 (gmk)
Enzymes [BR:cul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CULC22_01241 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 RsgA_GTPase MMR_HSR1 AAA_25 AAA_22 NTPase_1 AAA_29 CPT Cytidylate_kin ABC_tran Rad17
Motif
Other DBs
NCBI-ProteinID: AEG83951
Position
complement(1371105..1371680)
Genome map
AA seq 191 aa AA seqDB search
MTGDNPKGRLVVLAGPSAVGKSTVVHRLREEVPNLYFSVSMTTRVPRPGEVDGVDYFFVT
PEEFQSRIDGGDMLEWAEIHGGLQRSGTPAGPVEDALSAGRPVLVEVDLVGARNVAALKP
DAETVFLAPPSWEVLVDRLTGRGTEPEDVIKRRLETARQELASQDEFKHVVTNDKVNETV
AEIRDILLGCC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgataacccaaaaggtcggctagtcgttttagctggaccatctgctgtgggg
aagtccacggtggttcatcgccttcgcgaggaagtaccgaacctctacttcagtgtttcg
atgaccacaagggtaccgcgtcccggtgaagttgatggtgtggattacttcttcgtgact
cccgaggagtttcagtctcgtatcgacggtggagatatgctcgaatgggcagaaatccat
ggtggattgcaaaggtctggaactcccgcggggcctgtggaagacgcgttgtcagccggc
cgtcctgtgctggttgaagtcgatcttgttggtgctcgtaacgtcgcggcgttgaagccc
gatgcagagaccgttttcctagctccgccatcgtgggaagtccttgtggatcgtcttact
gggcggggaacggagcctgaagacgtgatcaagaggcggctagagactgcacgtcaggag
ctagcatcccaggatgagtttaagcacgttgtaaccaacgataaggttaatgagacggtc
gctgagattcgggatatcctgctcgggtgttgctaa

DBGET integrated database retrieval system