KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01401Help
Entry
CULC22_01401      CDS       T01549                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cul00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550310..1551404)
Genome map
AA seq 364 aa AA seqDB search
MSTGGRTLYPFSAVVGQDRLRLALILCAISPRIGGVVIRGEKGTAKTTTVRAFASLLGDA
PLVDLPIGATEDRVVGSLDMETILTTGKAHYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVVASKDVEIR
AEIMRRRLAFESTPQSFVQSWAHEDASTAQLIHEAKQRVQQLQLSDVNLSRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASTVEDEDIRIAAELALPHRRRRDPFDELGLDQDQLDQ
EMDNAQKQHPDEEGNAESDSEGPQDEANQNEVEEKSSEEQAEQPTSDGQEERATTGAPFR
SAGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcactggtggacgtacgttgtatccgttttcggcagttgtggggcaggatcgacta
agacttgcactcatcctgtgtgcgatttctccgcgcattggtggcgtggtcatccgtggg
gaaaagggaacagccaagacaaccacggtgcgagcttttgccagtttgctgggggatgct
ccattagttgatcttcccatcggagccacggaagatcgagttgtgggctcccttgacatg
gaaacgatcttgaccacgggcaaggctcactataatcccggtttgctgagccaggcagac
ggtggagtgctgtacgttgatgaggtaaatctgcttgcggatcacctggttgattcgctc
ttagacgccgcagcgacagggcaggttacagtcgaacgggacggtatttcgcattcttcg
cctgccaattttgtgcttgtgggaaccatgaatccagaagaaggggagctgcgtccgcag
cttcttgatcgttttggtttggccgtcgatgtcgtggcctccaaagacgttgagattcgt
gcagagatcatgcggcgtcggctcgcatttgaatcgactccacaatcttttgttcaatca
tgggcccatgaggacgcatcaacagcacagctgatccatgaggcgaaacaacgagtgcag
cagctacagctttccgacgttaacctcagccggattgcacacctttgtgcggcatttgat
gttgatggtatgagggctgatctggttattgctcggactgcgctagcccacgctgcctgg
cgcggggcctcgacggtggaagatgaggatattcgcatagctgcagagttggctttgccg
catcgtcgccgcagagacccattcgatgaactcggcttagatcaggatcagctggatcaa
gaaatggataatgctcagaaacagcacccagacgaggaaggcaacgcggaaagcgactcg
gaaggacctcaggacgaggcaaatcagaatgaagtagaagaaaaatcctcggaagaacag
gcggaacagcccaccagtgatggtcaggaggaacgcgctactactggcgctccctttcgc
tccgcgggtgtttaa

DBGET integrated database retrieval system