KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01535Help
Entry
CULC22_01535      CDS       T01549                                 

Gene name
glk
Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC22_01535 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_01535 (glk)
   00052 Galactose metabolism
    CULC22_01535 (glk)
   00500 Starch and sucrose metabolism
    CULC22_01535 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC22_01535 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CULC22_01535 (glk)
   00524 Butirosin and neomycin biosynthesis
    CULC22_01535 (glk)
Enzymes [BR:cul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CULC22_01535 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1702175..1703128)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIELVDALRQKH
EISAVGLAVAGFLDPDCEVVRFAPHLPWRDRAVRAELSESLGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRVCSCGKRGCL
ERYCSGTALETTAREMIAAGKATDSVLIDALANGSLSGKRIMAAAGDGDQLACAVVEDFA
QWMGRALSIVADVLDPGLIVIGGGVSTASALYLDTAVETMSTSMVGAGYRPLPKVSCAEL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggaactaacatgcgg
gcggcggcggtgacttcggatgggcagattattgactctatgtcggttcctacgccatcg
actcctgaattgctcgaatccggaatcatcgagctggtagacgctctgaggcagaagcat
gagatttccgcagtagggttggcggtagctggttttttggatcctgattgtgaagttgtt
cgttttgctccgcatctcccgtggagagatcgagctgttcgcgcagagctttcagagtcc
ctaggattaccggttcgtctcgagcacgatgcaaattcggcagcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctctttgccgtaggaaccggaattggt
gcaactctcatgcatcaaggagagatttatcgtggagcgtttggcacagcgccagaattt
ggtcatctcactgtagtcccagggggacgggtatgctcctgtggcaaacgtggatgtcta
gaacggtactgttcaggaacggctttggaaactactgctcgtgagatgattgcagcgggc
aaagcaaccgactccgtgcttatcgacgctctagctaacggttccttaagcggtaaacgc
attatggctgcagctggtgatggtgatcagcttgcttgcgccgttgtagaagatttcgcc
caatggatgggacgagctctgtccatagtggcagatgtccttgatcccggacttatcgtg
atcggtgggggagtatccactgcaagcgcactctacctcgatactgccgtggagacgatg
agtacatcgatggtgggggcagggtaccgcccccttcccaaagtttcgtgtgcggagcta
ggtggagatgcgggtatgatcggggtatctgatttggctcgccaattggtctga

DBGET integrated database retrieval system