KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01577Help
Entry
CULC22_01577      CDS       T01549                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cul01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cul00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cul00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1749699..1751267)
Genome map
AA seq 522 aa AA seqDB search
MPGSVASSYDIKIDAIGGGSDKKCPSVFFSARAVDASVVAVHYISTRDTSQTPVAFTDIL
LGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALAAEVLKLFVDDIPAADLEAIT
ARAYTTPKFADEEIVPVTKLEDGTYIGHLSEGPTAAFKDMAMQLLGELFEYELRRRKETL
NILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQAQMFGLDDPNIFNIALDGVF
DDCQDVVKAVSSDADFKANNHIGAVNSINWARLMAQVVYYISSWLKVTENNDQKVSFCVP
TGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFKTGEYRVRSAAETHETSSPSMDI
SRASNFERFIFDLLGRDAERCSELFGEQVKAGGFSLADDESFEHAATHYGFASGSSTHAD
RIATIADCYTRRGLMVDPHTADGVKVAREWASQIESPIVCLETALPVKFTDTIVEAVGRG
PEIPERFTGILDAPRHVTDLPNDVAAVKDFILESIARDTAGA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctcagtcgcgagctcatacgatataaaaatcgatgcaattggtgggggtagc
gataagaaatgtccatccgttttcttcagcgctagagccgtcgacgctagtgtagtagcc
gtgcactacatttcgacaagagacacttcccagacccccgtagcgtttactgacatactt
ttgggtggtcttgccccagacggcggtttgtaccttcctgagtattatccgcgtctcgac
gctgccacgttagatacctggcgcggtattctcgcccagcaaggttacgcagcactagcc
gcagaagtgcttaagctctttgtcgacgacatcccggcagcggatctagaagccattact
gcgcgcgcttacacgacgcccaagtttgccgacgaagaaatcgtcccggtgaccaagctc
gaggacggcacttatataggccacctatctgagggaccgaccgctgcattcaaagacatg
gccatgcagcttcttggcgagctctttgaatatgagctacgccggaggaaagagacctta
aacattctgggtgccacctctggcgacacaggatcctctgctgaatacgcgatgcgtggg
cgtgcaggaatccgtgtgttcatgctcacccctaaagaccgcatgacgccattccagcag
gcccagatgtttggtctggatgacccaaatatctttaatatcgcgctagatggcgttttt
gatgattgtcaagacgtggttaaagctgtgtcgtccgacgcggattttaaagcgaacaac
cacattggtgcagtgaactcaattaactgggcccgtttgatggcgcaagtggtctactac
atttcttcgtggctcaaagtaacggagaacaacgatcaaaaagtgagtttctgcgttccc
accggaaactttggcgatatctgtgccggacacattgctaagcaaatggggctgccgatc
gacaggctcatcgttgccaccaatgaaaacgatgttcttgatgagttctttaaaaccggt
gagtaccgtgtgcgctctgcagctgagactcatgagacatcctcgccctcgatggatatt
tctagagcgtccaactttgagcggtttatttttgacctgttaggaagagatgccgagcgc
tgctcagaactctttggggaacaagtaaaagctggcggtttttctcttgccgatgacgaa
tcatttgagcacgctgccacgcattatggttttgcgtcgggtagttccacccacgcagac
cgtatagccaccatcgccgattgctatacgcgccggggcctgatggtggatccgcatacc
gctgatggcgtgaaagtcgcgcgcgagtgggctagccagattgaaagccccatcgtgtgt
ttggagaccgctctacccgtgaaattcacggataccattgtagaagcagtaggacgcggt
cctgagattccagagcgctttactggaatcttggatgcaccacgccatgtcacagatcta
cctaatgatgtggctgcagtgaaggacttcattctagagagtattgctcgagatactgcg
ggtgcttaa

DBGET integrated database retrieval system