KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01634Help
Entry
CULC22_01634      CDS       T01549                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CULC22_01634 (malQ)
Enzymes [BR:cul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CULC22_01634 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1811291..1813477
Genome map
AA seq 728 aa AA seqDB search
MGYTDSLRELAAAHAVSWSFTGFGGEVTEVSEDTLVKTLRALGVRFGNEPEDSPNDHMPL
DAPMPSEEQIRTALQKRHDEEGTRPLPRCVVATQGDPYVFNVHVHDGAPADITITLEDGS
VAADVTQVENWTPPRTVDGITWGEASFQIPNDLPLGWHTITLTSDTLTASCFLIITPQQL
STARTFVDNPATGVMAQLYSVRSNDSWGMGDFHDLGELAKVVANKAGADYILVNPMHAAE
PFPPVEDSPYLPTTRRFINPIYIRIEDIPEHLSLSDELQEEIAEISSTFKTLNHSSDKIE
RNPIYDAKLQVLHAIFEAERDPAREQDFRDFVASEGDGLYDFALWCAHQEIAHLTESSSH
AAIPTPEDAAEFYMWLQWICDQQLGAAQSAAIDAGMSIGIIADLAVGIHPGGADAQSLAD
SLAPRASVGAPPDNYNQQGQDWSQPPWHPDRLAEAGYVPWRDLLRTVLRHAGGIRVDHIL
GLFRLFWIPRMQSPATGAYVNYDHNALVGVLALEAERAGAVVIGEDLGTYEPWVQEFLAQ
RGIMGTSVLWFESSPTGGPRHQNEYRELALTSVTTHDLPPTAGLLAGEHIELRKDLGILT
VDPEQEHEQDIRWQSEILDEIKNSGAFSGDTVPETFQGLTREERGTADTLLPAIHKFLAS
TPSALTCTALVDLVGDRRAQNQPGTTSDMYPNWCIPLCDGNTQALTIEDIADLPLFQAVA
EASKRNKR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgggttatacagattcgctgcgcgaactcgcagcagcacatgcagtttcttggtcattt
accggattcggcggcgaagtaaccgaagtcagcgaagatacgctggtaaaaacacttcgt
gcgttgggcgttcgctttggaaatgagcccgaggacagtccgaacgatcatatgccgctc
gacgcacctatgccgagcgaggaacagatccgtaccgctcttcagaagcgtcacgacgaa
gaaggcacgcgtccgctgccccgttgcgtcgtcgcaacgcaaggagacccttacgtcttc
aacgtgcacgtccatgacggtgcccccgcggacatcacgattacgctggaagacggctca
gtcgcagccgatgtcacccaagttgaaaactggacgccaccgcgcactgtcgacggcatc
acctggggtgaggcctccttccagatccccaatgatcttccgctcggttggcacaccatc
acgctaacctccgacacactcactgccagctgtttcctcatcattactccgcagcaactc
tccacagcacgcacatttgtggataatccggctaccggagtgatggctcagctctactct
gtacgtagcaacgactcgtggggaatgggagactttcatgacctcggcgaactggctaaa
gtcgtggccaacaaagccggggcagactacatcctggtcaatccgatgcacgcagccgag
ccttttccaccggtcgaggactccccttatctgcccaccacgcgacgctttatcaatccc
atctatattcgcatcgaggacatacccgagcacctcagtctcagcgacgagctgcaagag
gaaatcgcggagatttcttctacgtttaaaactctcaaccactccagcgacaaaatcgaa
cgcaacccgatttacgacgcaaagctccaagtacttcatgcgatttttgaggccgagcgc
gatcccgctcgtgaacaggacttccgcgactttgtagcctctgaaggtgacggcctttac
gacttcgctctgtggtgtgcacaccaagaaatcgcccatctcacggagtccagctcccac
gctgcgataccgacgcccgaggatgctgcagaattctacatgtggcttcagtggatctgt
gaccagcaactgggcgcagcacaatctgctgctatcgacgccggcatgagcatcggaatc
atcgccgacctcgccgtggggatccaccccggcggtgccgacgcccaaagcctcgcagat
tccctagcaccgcgtgcatctgttggcgctccaccagataactacaaccagcaagggcaa
gactggtctcagccaccatggcaccccgaccgtctcgccgaggccggctacgtgccgtgg
cgcgatctgcttcgcactgtcctacggcacgctggtggcatccgcgtagaccacattctg
gggcttttccggctcttctggatccctcgcatgcagtcccctgccaccggagcgtacgtc
aactatgaccacaacgccctggttggagttctagcgctcgaagccgagcgtgccggcgca
gtagtcatcggtgaagacctcggaacgtatgaaccgtgggttcaagaattcctcgcacaa
cgcggcatcatgggcacgtcggtgctctggttcgaaagttcccccacgggagggccgagg
caccaaaatgagtaccgcgaactcgcactcacctctgtgaccacgcacgaccttcccccc
accgcggggctccttgccggcgagcacatcgagttacgtaaagatctcggtattctcacc
gtcgatccggagcaagaacacgagcaagatattcgttggcaaagcgagattctcgacgaa
atcaaaaattctggcgccttctccggcgacacggtgccagaaactttccaggggcttacg
cgggaagagcgcggcactgcagacacccttctaccggctatccacaagttcctagccagc
acaccttctgcgctcacgtgcaccgccctcgtggatcttgtcggcgaccgtcgagctcaa
aaccagcccggcacaacctccgacatgtatcccaactggtgtatcccactgtgcgatggc
aatacccaagccctcactattgaagacatcgctgatcttcccttattccaagcagtagcg
gaagcatcaaagagaaacaagcgctaa

DBGET integrated database retrieval system