KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01813Help
Entry
CULC22_01813      CDS       T01549                                 

Gene name
pncA
Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CULC22_01813 (pncA)
Enzymes [BR:cul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CULC22_01813 (pncA)
    3.5.1.-  
     CULC22_01813 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987890..1988444
Genome map
AA seq 184 aa AA seqDB search
MRALIIVDVQNDFCPGGALETVKGAIQAQSIAEYTALHGKKYGCIAATKDWHIDPGDHFS
ETPDFIDTWPVHCMAHTEGADFHPLLLNTRFDEVFYKGHYSAAYSGFEGSTADGQLLSTW
LKDRGVREIDIAGIATDYCVQATALDGLREGFQVTVLSSLCAAVNEDNTRAVLRRLTDHG
CVLG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctcatcattgttgacgtccaaaatgatttttgtccgggcggggcgttagaa
acggtcaagggtgcaattcaagcacaatctattgcagaatacacagcacttcacgggaaa
aaatacggctgcattgcagccaccaaagactggcatatagaccctggcgatcacttttct
gaaaccccagattttattgatacgtggcccgtacattgtatggctcatacagagggcgcc
gattttcatccgctgctcttaaacacgcgctttgacgaggtgttctataaagggcactac
agcgccgcctactcagggttcgagggttccacggcagatgggcaactcttaagcacatgg
ctaaaagaccgtggggtacgcgagattgatatcgcggggatcgctacggattactgtgtt
caggctacggctctcgacggtctacgagaaggcttccaggtaacggtgctctcgagcctg
tgcgccgccgtcaatgaggacaacacccgcgcagttttgcgtaggctcacagaccacggg
tgtgtcctcggttaa

DBGET integrated database retrieval system