KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02021Help
Entry
CULC22_02021      CDS       T01549                                 

Gene name
folP2
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CULC22_02021 (folP2)
Enzymes [BR:cul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CULC22_02021 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2200539..2201321)
Genome map
AA seq 260 aa AA seqDB search
MTHVMGIVNVTADSFSDGGKYLDLDSAVAHAKQLVAEGADIIDVGGESTRPGATRVSEQA
ELARVVPVIKALHAEGIRTSVDTMRASVAAAAAEAGVSMLNDVSGGLADKNMYSVMADTQ
LPVCLMHWKTGTFGDAAGAHHTDVVREVHEGLDILVDNALAAGIDAKAIVIDPGLGFAKT
AEDNWALLNALPEFMREYPVLVGASRKRFLASLGSDVDAATAAVTAIAAHQGVWCVRVHN
VALSRAAVDVAAKWRKHGSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgtaatgggaatcgtcaacgtgactgctgattccttttctgatggcggaaag
tatctcgatctcgactccgcggtggcgcatgccaagcaactcgtggcagagggcgctgac
atcatcgacgtaggcggcgagtccacccgcccaggtgccactcgcgtgagcgagcaggct
gagcttgcccgcgtcgttcctgtgattaaagccctgcatgctgaaggaatcaggacgtca
gtagataccatgcgtgcctcggtcgctgccgcagcagccgaggccggggttagcatgctt
aacgacgtctccggcggcctcgcagataagaacatgtactcggttatggctgatacacag
cttcccgtgtgcttgatgcactggaaaacagggacctttggggatgccgcaggcgcgcat
cataccgacgtggtgcgtgaagttcatgagggcctggacatactcgttgataacgccctt
gccgctggcattgacgcgaaagccattgtcatcgacccaggactcgggtttgctaaaacc
gcagaggacaactgggctttattgaacgctcttccagaatttatgagagagtatccggta
ctcgtgggggcgtcgagaaagcgctttttagctagcctaggctcagacgtggacgcggcg
actgccgcagtcacagcaatcgcggcgcatcaaggtgtgtggtgtgtccgggtgcacaac
gtggcgctatcccgtgccgctgtggatgttgcggcgaaatggaggaagcatggatcgcat
tga

DBGET integrated database retrieval system