KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02122Help
Entry
CULC22_02122      CDS       T01549                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CULC22_02122
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_02122
  Lipid metabolism
   00071 Fatty acid degradation
    CULC22_02122
  Amino acid metabolism
   00350 Tyrosine metabolism
    CULC22_02122
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CULC22_02122
   00626 Naphthalene degradation
    CULC22_02122
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CULC22_02122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2314941..2315978)
Genome map
AA seq 345 aa AA seqDB search
MKNDFPEAFTAAVVDDFGPELTIHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGA
HGVLVTAVHPQAFGQAIGMTRKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLDDVNSVFADMHQGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaa
ctcactattcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaacta
gtagcttccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaa
ccggaaccaccgtttgttcctgggcatgaaggcgtgggcgaagtcgttaaattagggcct
ggccatcacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgt
ggggagtgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggt
ggctacacggttgatggctccttcggtgaatacatgttggtagatacccgttactgtgct
cgtattccagagggatctgaccccatcgaggttgccccgatcttgtgtgctggtgtgact
gtatataagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggt
atcggcggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaatt
gcagtggatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgca
gtaaatgcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcg
catggcgttctggtcaccgctgttcacccgcaagcgttcggtcaagccattggtatgact
cgaaaaggtggaacgatcgtatttaatggtcttcctccaggagagttccctgcacctatc
tttgagattgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggat
ttggaagaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgc
aagcttgacgacgtcaacagtgtcttcgccgatatgcatcagggcaaagtcgatgggcgc
atggcgattaggtactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system