KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02122Help
Entry
CULC22_02122      CDS       T01549                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00010  Glycolysis / Gluconeogenesis
cul00071  Fatty acid degradation
cul00350  Tyrosine metabolism
cul00625  Chloroalkane and chloroalkene degradation
cul00626  Naphthalene degradation
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01130  Biosynthesis of antibiotics
cul01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_02122
  Lipid metabolism
   00071 Fatty acid degradation
    CULC22_02122
  Amino acid metabolism
   00350 Tyrosine metabolism
    CULC22_02122
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CULC22_02122
   00626 Naphthalene degradation
    CULC22_02122
Enzymes [BR:cul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CULC22_02122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11 TRAM
Motif
Other DBs
NCBI-ProteinID: AEG84827
Position
complement(2314941..2315978)
Genome map
AA seq 345 aa AA seqDB search
MKNDFPEAFTAAVVDDFGPELTIHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGA
HGVLVTAVHPQAFGQAIGMTRKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLDDVNSVFADMHQGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaa
ctcactattcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaacta
gtagcttccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaa
ccggaaccaccgtttgttcctgggcatgaaggcgtgggcgaagtcgttaaattagggcct
ggccatcacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgt
ggggagtgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggt
ggctacacggttgatggctccttcggtgaatacatgttggtagatacccgttactgtgct
cgtattccagagggatctgaccccatcgaggttgccccgatcttgtgtgctggtgtgact
gtatataagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggt
atcggcggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaatt
gcagtggatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgca
gtaaatgcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcg
catggcgttctggtcaccgctgttcacccgcaagcgttcggtcaagccattggtatgact
cgaaaaggtggaacgatcgtatttaatggtcttcctccaggagagttccctgcacctatc
tttgagattgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggat
ttggaagaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgc
aagcttgacgacgtcaacagtgtcttcgccgatatgcatcagggcaaagtcgatgggcgc
atggcgattaggtactaa

DBGET integrated database retrieval system