KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02226Help
Entry
CULC22_02226      CDS       T01549                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CULC22_02226 (deoA)
Enzymes [BR:cul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CULC22_02226 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2453891..2455177
Genome map
AA seq 428 aa AA seqDB search
MAEKFDAVDVIRTKRDKGKLSKGQIDWIIDAYTRGVVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEITADRDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAGLGEKVTKGQKLFTLHTDDEDRFDRALESLEPGVKISDEAPAPRT
SVILDRIS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaagttcgacgccgtagatgtcatccgcacaaagcgggataaaggaaagttg
agcaaggggcaaatcgactggatcatcgatgcctacactcgcggtgtcgtcggcgacgac
caaatggccgccctcaacatggcaatattcctcaatggcatggatcgagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgagaccatgagttttgccagcctctcccgc
cccaccacagacaagcactccaccggcggcgttggcgataaaatcaccctccctctcgca
ccgctcgttgccagctatggcgttgccgtgccacagctctccggaagaggactagggcac
accggcggaaccctggacaaactagaagccatccccggctgggaagccgacatagataac
gcccgcatgatgaagatcctggaagacccaggctgcgtagtatgcgccgcgggagccgga
ctggcaccagcagacaagaagatctatgcgctgcgcgacatcaccgctaccgtcgactgc
atccctttgatcgccagctccatcatgagtaaaaagatcgccgaaggaaccgcgaacctg
gtcctcgacgtcaaggtcggctctggcgcctttatgaaggagcttgatcaggcacgcgag
cttgcccgcaccatggttgaccttggccgcgacgccggaaccaacatggtcgcactcctc
acagacatgtccgtacctctaggtcgcaccatcggcaacgccctggaagttcgcgagtcc
gtagaagtactcgcaggtggcgggccttccgacgtcatagagctcacctgcgctcttgca
acagaaatgcttgaactcgccggcgtccacgatcctgacgtgcatgaagcgcttgccgac
ggccgcgcaatggattcctggaagaagatgatccgtgcacagggcggcgaccccgacgct
gcactccccaccgcacgccacacccacgagatcactgccgaccgcgacggctacctcaca
gaaatggatgccctcgcactaggcgtagccagctggcgacttggcgcaggacgtgcccgc
aaggaagacccagtccagcttggcgctggcatcgagattcatgcaggactcggcgagaag
gtaacaaaaggccagaagctcttcaccctccacaccgacgatgaagaccgttttgaccgc
gccctagagtctctcgaacccggcgtaaagattagcgacgaggccccggccccacgcact
tcggtcatcctcgaccgcatcagctag

DBGET integrated database retrieval system