KEGG   Corynebacterium ulcerans BR-AD22: CULC22_02332Help
Entry
CULC22_02332      CDS       T01549                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00260  Glycine, serine and threonine metabolism
cul00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01130  Biosynthesis of antibiotics
cul01230  Biosynthesis of amino acids
Module
cul_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC22_02332 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CULC22_02332 (trpA)
Enzymes [BR:cul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CULC22_02332 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AEG85034
Position
2581542..2582381
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLAIIRTAVKAGADALEIGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLSLIAQTRSEFPDLPIGLLIYGNVPFTRGLDTFYQEFAT
AGADSILLPDVPVREGAPFITAAQQAGIAPIFIAPAQASEDTLRDVAAHSEGYIYAISRD
GVTGTERESSTSGLSDVVANITAFGGAPTLLGFGISTPQHVRDAMAAGARGVITGSAITA
IIERHCVGTHPQPATIDDMPALQSEISAFIAEMKEATRK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaaccttttcacccgactagagcaatccaatgaaggagcctttgtt
cctttcatcatgctcggcgacccttctcccgaagcatcacttgcaatcattcgtaccgct
gtcaaagccggcgcagatgcacttgagattggcgttcccttctcagacccggtggccgac
ggcccaaccatccaacgatctcatctccgcgccttggataatggagcaaccgtcgattcc
tctttgtcgctcattgctcagactcgttcagaatttccagacctgcccatcggcctcctg
atctacggcaacgtccccttcacccgcggactagacaccttctatcaagaattcgccacc
gccggcgccgattctattttgcttcccgacgtcccagtacgggaaggggcacctttcatc
acagcagcacaacaggcagggatcgcacctattttcattgcacccgcacaggcatcggaa
gataccctccgagacgtggcagcacattctgaaggctacatctacgcaatttctcgcgat
ggggtcaccggcacagaacgggaatcctccactagcggactcagtgacgtagtagcaaac
atcacggcattcggcggtgcccctacgcttctcgggttcggaatttccactccccagcac
gttcgcgacgcgatggcggccggggcaaggggagtaatcaccggatccgccatcacagca
atcattgaacgccactgtgttggtacacaccctcagcccgcaacaatcgatgacatgccc
gcgttgcaatcggaaatttccgcttttatcgctgagatgaaagaagcaactcgcaagtaa

DBGET integrated database retrieval system