KEGG   Corynebacterium urealyticum DSM 7109: cu0179Help
Entry
cu0179            CDS       T00685                                 

Gene name
fadA1
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cu0179 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    cu0179 (fadA1)
   00640 Propanoate metabolism
    cu0179 (fadA1)
   00650 Butanoate metabolism
    cu0179 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    cu0179 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    cu0179 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cu0179 (fadA1)
   00310 Lysine degradation
    cu0179 (fadA1)
   00380 Tryptophan metabolism
    cu0179 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cu0179 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cu0179 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cu0179 (fadA1)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cu0179 (fadA1)
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cu0179 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(223170..224399)
Genome map
AA seq 409 aa AA seqDB search
MTSNSGAPEAFIYDAVRTPRGKGKPGGSLHTVKPVSLLSGLIEAILERNPGLDPARINDV
IAGCVTPVGDQGMDIARTAALNAGLPYSATGLQVNRYCASGLTALNLAAQKVRSGWDELV
FAGGVESMSRVPMGSDGGALALDPESNFYNDFIPQGISADIIASLDGMTREDLDAFAARS
HERAAKAWEEGRFDRTVVPVKDQNGQVLLDRDETIRQGTTVESLSGLRPAFAMIGDQGGF
DAVAQTKYPQLERINHLHHAGNSSGIVDGAALLAIGSEKAGQEMDLEPRARVVSVATTGV
EPTIMLTAPAPASRAALAKAGLKPEDIDVWEINEAFSSVVLRAQRELNIPDEKLNISGGA
IAMGHPLGATGAIITGNAIDELHRTGGRYALITLCVAAGMGVATIIERV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtaactctggcgcccctgaggccttcatctacgacgccgtccggacgccccgc
ggaaagggcaagcccggcggatccctgcacaccgtcaagccggtcagcctgctcagcggg
ctgatcgaggccatcctggagcgcaacccgggcctggacccggcgcgcatcaacgatgtc
atcgcgggctgcgtgacccccgtcggcgaccagggcatggacatcgcccgcaccgcggcc
ctcaacgccggcctgccgtactccgcgaccggactgcaggtcaaccgctactgcgcatcc
ggcctgaccgccctcaacctcgccgcgcagaaggtgcgttccggctgggatgagctcgtc
ttcgctggtggcgtggagtccatgtcccgcgtgccgatgggttccgatggtggtgccctc
gccctcgacccggagtccaacttctacaacgacttcatcccgcagggcatctccgcggac
atcatcgccagcctcgacgggatgacccgcgaggacctcgacgccttcgccgctcgctcc
cacgagcgcgccgccaaggcctgggaggagggccgcttcgaccgcaccgtcgtcccggtc
aaggaccagaacggccaggtgctgctggaccgcgacgagaccatccgtcagggcaccacc
gtggagtccctctccggcctgcgcccagccttcgccatgatcggcgaccagggcggcttc
gacgccgtcgcgcagacgaagtacccgcagctcgagcgcatcaaccacctgcaccacgcc
ggtaactcctccggcatcgtcgacggcgcagccctgctggccatcggctccgagaaggcg
ggtcaggagatggatctcgagccgcgcgcccgcgtcgtctccgtcgccaccaccggcgtg
gagccgaccatcatgctcaccgcaccggcaccggcgtcccgcgccgcactggccaaggcc
ggcctgaagccggaggacatcgacgtctgggagatcaacgaggcattctcctccgtcgtc
ctgcgcgcacagcgcgagctgaacatcccggatgagaagctcaacatcagcggtggcgcc
atcgccatgggccacccgctgggcgcgaccggcgcgatcatcaccggtaatgcaatcgac
gagctgcaccgcaccggcggccgctacgcactgatcaccctgtgcgtcgcagccggcatg
ggcgtggccaccatcatcgagcgcgtctaa

DBGET integrated database retrieval system