KEGG   Corynebacterium urealyticum DSM 7109: cu1135Help
Entry
cu1135            CDS       T00685                                 

Gene name
fadA3
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00071  Fatty acid degradation
cur00280  Valine, leucine and isoleucine degradation
cur00310  Lysine degradation
cur00362  Benzoate degradation
cur00380  Tryptophan metabolism
cur00620  Pyruvate metabolism
cur00630  Glyoxylate and dicarboxylate metabolism
cur00640  Propanoate metabolism
cur00650  Butanoate metabolism
cur00900  Terpenoid backbone biosynthesis
cur01100  Metabolic pathways
cur01110  Biosynthesis of secondary metabolites
cur01120  Microbial metabolism in diverse environments
cur01130  Biosynthesis of antibiotics
cur01200  Carbon metabolism
cur01212  Fatty acid metabolism
cur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cu1135 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    cu1135 (fadA3)
   00640 Propanoate metabolism
    cu1135 (fadA3)
   00650 Butanoate metabolism
    cu1135 (fadA3)
  Lipid metabolism
   00071 Fatty acid degradation
    cu1135 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    cu1135 (fadA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cu1135 (fadA3)
   00310 Lysine degradation
    cu1135 (fadA3)
   00380 Tryptophan metabolism
    cu1135 (fadA3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cu1135 (fadA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cu1135 (fadA3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cu1135 (fadA3)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cu1135 (fadA3)
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cu1135 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CAQ05095
UniProt: B1VH54
Position
complement(1344993..1346309)
Genome map
AA seq 438 aa AA seqDB search
MTNGNQKKVAILGGNRIPFARSNKEYADASNQDMLTAAIEGLVARYGLQDEELGLVTGGA
VLKHSRDFNMVREVVLGSSLSNTTPAMDMQMACGTGLAAIVAVGDAIRAGRIESGIGSGV
DTTSDAPLAVGDQLRKTLIKLTQAKTTQQRLKLVGSIRPAQLAPDQPSNGEPRTGLSMGD
HAAITAREMNITREEQDEFAATSHQNLAKAYDEGFFEDLITPYLGVQRDTNLRPDSTPEK
LAKLKPVFGKRDAAQHGTTATMTAGNSTPLTDGASAVLLSSEEWAKERNLPVRAYLVDSE
VASVDFLHGHDGKTPDGLLMSPTYAVPRMLERNGLTLQDFDFYEIHEAFASQTLATLKAW
ESEEYCRERLGLDKPLGAIDRSKLNVKGSSLAAGHPFAATGGRIIATTAKLLEENGGGRA
LVSICAAGGQGIVAIVER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacggtaaccagaagaaggtcgccatcctcggcggcaaccgcattcctttcgcc
cgctccaacaaggagtacgcggacgcatccaaccaggacatgctcaccgcggccatcgag
ggcctcgtcgcccgctacggcctccaggacgaagagctcggcctggtcactggcggtgcg
gtcctgaagcactcccgcgacttcaacatggttcgcgaggtcgtgctgggctcctccctg
tccaacaccaccccggccatggacatgcagatggcctgtggcaccggcctggccgccatc
gtcgccgtcggcgatgccatccgcgcgggccgaatcgagtccggcatcggctccggcgtg
gacaccacctccgacgccccgctggcggtcggcgaccagctgcgcaagactctcatcaag
ctgactcaggccaagaccacccagcagcgcctgaagctggtcggctccatccgcccggcc
cagctggcaccggatcagccgagcaacggcgagccgcgcaccggcctgtccatgggtgac
cacgctgcgatcaccgcccgtgagatgaacatcacccgcgaggagcaggacgagttcgcc
gcgacctcccaccagaacctcgcgaaggcttatgacgagggcttcttcgaggacctcatc
accccgtacctcggcgtgcagcgtgacaccaacctgcgcccggactccaccccggagaag
ctggccaagctcaagccggtcttcggcaagcgcgacgccgcgcagcacggcaccaccgcc
accatgaccgccggtaactccaccccgctgaccgacggggcatccgccgtcctgctctcc
tccgaggagtgggccaaggagcgcaacctcccggtccgtgcctacctggtggactccgag
gtcgcttccgtggacttcctgcacggccacgacggcaagaccccggacggcctgctgatg
agcccgacctacgccgtcccgcgcatgctggagcgcaacggcctgaccctccaggacttc
gacttctacgagatccacgaggccttcgcctcccagaccctggccaccctgaaggcctgg
gaatccgaggagtactgccgcgagcgcctgggcctggacaagccgctgggtgcgatcgac
cgctccaagctcaacgtcaagggctcctcgctggccgctggccacccattcgccgcaacc
ggtggccgcatcatcgccaccaccgcgaagctgctcgaggagaacggcggcggccgcgca
ctggtctccatctgtgcagcaggtggccagggcatcgtcgccatcgtcgagcgctaa

DBGET integrated database retrieval system