KEGG   Corynebacterium urealyticum DSM 7109: cur_0178Help
Entry
cur_0178          CDS       T00685                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0178 (fadB1)
   01212 Fatty acid metabolism
    cur_0178 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cur_0178 (fadB1)
   00650 Butanoate metabolism
    cur_0178 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    cur_0178 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    cur_0178 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cur_0178 (fadB1)
   00310 Lysine degradation
    cur_0178 (fadB1)
   00380 Tryptophan metabolism
    cur_0178 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cur_0178 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cur_0178 (fadB1)
   00281 Geraniol degradation
    cur_0178 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    cur_0178 (fadB1)
Enzymes [BR:cur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     cur_0178 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cur_0178 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     cur_0178 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(220811..223081)
Genome map
AA seq 756 aa AA seqDB search
MSNNMFAWDVDADGILTLTMDDPNAPVNTMNTTFQDDLTATVAKVKEAVEAGEVKGVVIA
SAKKTFFAGGDIKSMIKATPADAAELTQQIDQMKADLRALETLGVPVAAAINGTALGGGL
ELALATHHRVASDAKGLKVGLPEVTLGLLPGGGGVTRVTRMLGLQDALMKVLTTGRQFGA
QDALKTGLIDEVVPADQLLDAAKKWVKENPDAKQPWDTEGYKVPGGTPTNPKLAAFLPSF
PANVTKQIKGAPMPAPKAILAAAVEGLQLKNIEEATRVETRYFVDLVTGSTSKNMMQAFF
FDLQYCNGGGSRPKDVPRKQFKKLGMVGAGMMGAAIAYVAAKAGMEVVLKDIKLEAAEKG
KAYSEGLEAKALKRGKTTEEKSKALLDRITPSVDYSDLSDCDIVIEAVFENTELKHKVWA
EIEAAVPEDCVLGSNTSTLPITELATGVKRPKDFIGIHFFSPVDKMPLVEIIKGEETSDE
TLAAALDFTGQIRKTPIVVNDSRGFYTSRVISFFLNEAMRMLAEGIDPAVIEAAGRQAGY
PAPPLQLQDELNLKLARKIGAETKAAQEAAGISVDDGGVTEIVDKMLDVYDRPGKLEGKG
FYEYNEEGRRTGLWRGLWDELGGGSVTVPDAESATAGHGLESISTEGPVLVDLVERMLFA
EALETQKCIDEGVLMSDADANIGSIMGIGFPAWTGGTRQYIKNYARPAAAALPEGKKADV
DGGDYPTTGVAGFVARAEELAAKYGERFTPLDSLKS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacatgttcgcgtgggatgtcgacgccgatggcatcctcaccctgacgatg
gatgacccgaacgcgccggtcaacaccatgaacaccaccttccaggacgacctcaccgcc
accgtggcgaaggtcaaggaggccgtcgaggccggcgaggtcaagggcgtggtgatcgct
tccgcgaagaagaccttcttcgccggcggcgatatcaagtccatgatcaaggccaccccg
gcggatgccgccgagctgacgcagcagatcgaccagatgaaggccgacctgcgtgccctg
gagaccctgggcgtgccggtcgcggcagccatcaacggcaccgccctcggcggcggcctc
gagctggctttggccacccaccaccgcgtcgcctccgacgccaagggcctgaaggtcggc
ctgccggaggtcaccctcggcctgctgccgggtggcggcggcgtgacccgcgtgacccgc
atgctgggcctgcaggacgcgctgatgaaggtcctgaccaccggccgccagttcggcgcc
caggacgcgctgaagaccggcctgatcgacgaggtcgtcccggccgatcagctgctcgat
gccgcgaagaagtgggtcaaggaaaacccagacgcgaagcagccgtgggacaccgagggc
tacaaggtcccgggtggcaccccgaccaacccgaagctggccgcattcctgccgtccttc
ccggcgaatgtcaccaagcagatcaagggcgcgccgatgccggcgccgaaggcgatcctc
gccgcagccgttgaaggtctgcagctgaagaacatcgaggaggccacccgcgtcgagacc
cgctacttcgtggacctcgtcaccggttccacctcgaagaacatgatgcaggccttcttc
ttcgacctgcagtactgcaacggcggtggctcccgcccgaaggacgtgccgcgtaagcag
ttcaagaagctgggcatggtcggcgccggcatgatgggcgctgccatcgcctacgttgct
gcgaaggccggcatggaggtcgtcctcaaggacatcaagctggaggcagcggagaagggc
aaggcctactccgagggcctggaggccaaggcgctgaagcgtggcaagaccaccgaagag
aagtcgaaggctctgctggaccggatcaccccgtccgtggactactccgacctttctgac
tgtgacatcgtcatcgaggcggtcttcgagaacaccgagctcaagcacaaggtctgggca
gagatcgaggcagcggtgccggaggactgcgtcctgggttccaacacctccaccctgccg
atcaccgagctggctaccggtgtgaagcgcccgaaggacttcatcggtatccacttcttc
tccccggtcgacaagatgccgctggtggagatcatcaagggcgaggagacctccgacgaa
accctggctgcggccctggacttcaccggccagatccgcaagaccccgatcgtcgtcaat
gactcccgcggtttctacacctcccgcgtcatcagcttcttcctcaacgaggccatgcgc
atgctggccgagggcatcgacccggccgtcatcgaggcagctggccgccaggctggctac
ccggcaccgccgctgcagctgcaggatgagctgaacctgaagctggcccgcaagatcggc
gccgagaccaaggccgcgcaggaggctgccggcatctccgtcgacgacggtggcgtcacc
gagatcgtggacaagatgctggacgtctacgaccgcccgggcaagctcgagggcaagggc
ttctacgagtacaacgaggagggccgccgcaccggtctgtggcgtggcctatgggacgag
ctgggcggcgggtccgtcaccgtcccggacgccgagtccgcgaccgccggccacggcctg
gagtccatctccaccgagggcccggtcctggtcgacctggtggagcgcatgctcttcgcc
gaggctctggagacccagaagtgcatcgacgagggcgtgctgatgtccgacgcggatgcc
aacatcggctccatcatgggcatcggtttcccggcgtggaccggcggcacccgccagtac
atcaagaactacgctcgcccggctgccgctgcgctgccggagggcaagaaggctgatgtg
gacggcggggactacccgaccaccggcgtggctggcttcgttgcccgcgccgaggagctg
gccgcgaagtacggcgagcgcttcaccccgctggactccctgaagagctag

DBGET integrated database retrieval system