KEGG   Corynebacterium urealyticum DSM 7109: cur_0188Help
Entry
cur_0188          CDS       T00685                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cur00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cur00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236005..237210
Genome map
AA seq 401 aa AA seqDB search
MMTSRLCLLPRFRSRTARPAAAALLVAGLSLAAGCSSGEEDAALTSASSSSMTTTPPAST
PETTPPAPQVPAEELAPKLLAVGVTDFESARAAVDAGVRHLFFGTGSDFSMLNGQGDPER
SIAALQRRAGEPLRVSVDEEGGMVQRLSELIGTLPAPRDMARTMTPEQVRGMMAEHGRKM
AELGFTVDFAPSIDLAGGENIEDNAIGSRSFGSDPQVVARYARAYVEGLLDAGITPVLKH
FPGHGHANGDSHTGEVFVPPVEQLKQADLKPFAELLEIPGVEVMMGHVQARGLNPDEPAS
VSPATYGLLRKGWEGFGGYQGVVYTDDLTGMRAITDRYPGAEAVVAALSAGADQGLTAAG
AFDLPELISAVTEAIRNGEIAPEQAQRSAERLAPPAEETEN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttcccgtctttgccttcttccccgtttccgcagtaggacggcgcgtcccgcc
gccgctgctctcctggtcgctggcctaagcctggctgccggctgttcttccggggaggag
gacgcagctcttacttccgcctcgtcttcttctatgacgacgacgcccccggccagcacc
ccagagaccacgccgccggcaccgcaggtgccggccgaggaactcgcaccgaaactcctc
gcggtcggggtgacggacttcgagagcgcgcgggcggccgtggacgccggggtgcggcac
ctcttcttcggcaccggttcggacttcagcatgctcaatgggcagggtgaccccgagcgg
agcatcgccgcgctgcagcgccgggcgggggagccgctgcgggtatccgtcgacgaggag
ggcgggatggtccagcggctctccgagctgatcggcaccctgcccgcgccccgggacatg
gcccgcaccatgacccctgagcaggtgcggggcatgatggcggagcacggccggaagatg
gccgagctgggattcaccgtggacttcgccccctccatcgacctggctggcggcgagaat
atcgaggacaacgcgatcggctcgcgttccttcgggtccgatccacaggtcgtcgcccgc
tacgcccgcgcctacgtggagggcctcctggatgctggcatcaccccggtgctcaagcac
ttcccgggtcatggccacgccaacggggattcccacaccggtgaggtcttcgtcccgccg
gtggaacagctcaagcaggctgacctgaagcctttcgccgagctgttggagatcccgggg
gtcgaggtgatgatggggcacgtccaggcgcgggggctgaaccccgacgagccggcctct
gtcagcccagccacctatgggctgctccgcaagggctgggagggcttcggcggctaccag
ggggtcgtctacaccgacgacctcaccgggatgcgcgcgatcaccgaccgctacccaggc
gcagaggccgtcgtcgcggcgctatccgcgggagctgaccaggggctgacagccgccggt
gccttcgaccttcccgagctcattagcgcggtcaccgaggcgatccgcaacggggagatc
gcgcccgaacaagcccagcgcagcgccgaacgtctcgccccgcctgcggaagaaacggaa
aactaa

DBGET integrated database retrieval system