KEGG   Corynebacterium urealyticum DSM 7109: cur_0188Help
Entry
cur_0188          CDS       T00685                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    cur_0188
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    cur_0188
Enzymes [BR:cur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     cur_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236005..237210
Genome map
AA seq 401 aa AA seqDB search
MMTSRLCLLPRFRSRTARPAAAALLVAGLSLAAGCSSGEEDAALTSASSSSMTTTPPAST
PETTPPAPQVPAEELAPKLLAVGVTDFESARAAVDAGVRHLFFGTGSDFSMLNGQGDPER
SIAALQRRAGEPLRVSVDEEGGMVQRLSELIGTLPAPRDMARTMTPEQVRGMMAEHGRKM
AELGFTVDFAPSIDLAGGENIEDNAIGSRSFGSDPQVVARYARAYVEGLLDAGITPVLKH
FPGHGHANGDSHTGEVFVPPVEQLKQADLKPFAELLEIPGVEVMMGHVQARGLNPDEPAS
VSPATYGLLRKGWEGFGGYQGVVYTDDLTGMRAITDRYPGAEAVVAALSAGADQGLTAAG
AFDLPELISAVTEAIRNGEIAPEQAQRSAERLAPPAEETEN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttcccgtctttgccttcttccccgtttccgcagtaggacggcgcgtcccgcc
gccgctgctctcctggtcgctggcctaagcctggctgccggctgttcttccggggaggag
gacgcagctcttacttccgcctcgtcttcttctatgacgacgacgcccccggccagcacc
ccagagaccacgccgccggcaccgcaggtgccggccgaggaactcgcaccgaaactcctc
gcggtcggggtgacggacttcgagagcgcgcgggcggccgtggacgccggggtgcggcac
ctcttcttcggcaccggttcggacttcagcatgctcaatgggcagggtgaccccgagcgg
agcatcgccgcgctgcagcgccgggcgggggagccgctgcgggtatccgtcgacgaggag
ggcgggatggtccagcggctctccgagctgatcggcaccctgcccgcgccccgggacatg
gcccgcaccatgacccctgagcaggtgcggggcatgatggcggagcacggccggaagatg
gccgagctgggattcaccgtggacttcgccccctccatcgacctggctggcggcgagaat
atcgaggacaacgcgatcggctcgcgttccttcgggtccgatccacaggtcgtcgcccgc
tacgcccgcgcctacgtggagggcctcctggatgctggcatcaccccggtgctcaagcac
ttcccgggtcatggccacgccaacggggattcccacaccggtgaggtcttcgtcccgccg
gtggaacagctcaagcaggctgacctgaagcctttcgccgagctgttggagatcccgggg
gtcgaggtgatgatggggcacgtccaggcgcgggggctgaaccccgacgagccggcctct
gtcagcccagccacctatgggctgctccgcaagggctgggagggcttcggcggctaccag
ggggtcgtctacaccgacgacctcaccgggatgcgcgcgatcaccgaccgctacccaggc
gcagaggccgtcgtcgcggcgctatccgcgggagctgaccaggggctgacagccgccggt
gccttcgaccttcccgagctcattagcgcggtcaccgaggcgatccgcaacggggagatc
gcgcccgaacaagcccagcgcagcgccgaacgtctcgccccgcctgcggaagaaacggaa
aactaa

DBGET integrated database retrieval system