KEGG   Corynebacterium urealyticum DSM 7109: cur_0191Help
Entry
cur_0191          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0191
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cur_0191
Enzymes [BR:cur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     cur_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(239868..241160)
Genome map
AA seq 430 aa AA seqDB search
MSTVGTPRTAAEIQKDWDENPRWAQVKRDYTAEQVAELQGNVLEEHTLARRGAEILWEAV
NKGDDSYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
NVVQRINNALMRADEIARVEGDDSVENWLVPIVADGEAGFGGALNVYELQKAMIKAGAAG
SHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVANTPTLVVARTDAEAATLLT
SDVDDRDKPFLTGGRTAEGFYNVQNGIEPCIARAKAYAPYADLIWMETGTPDLELAKKFA
EAVHEEYPDQLLAYNCSPSFNWSAHLEADEIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAYGYAREQMTAFVDLQNREFKAAEERGFTAVRHQREVGAGYFDAIATTVDPNSSTTA
LKGSTEEGQF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgtcggaactccacgtaccgcagctgaaatccagaaggactgggacgagaac
ccgcgctgggcacaggtcaagcgtgactacaccgctgagcaggtcgcagagctccagggc
aacgtcctcgaggagcacaccctcgcacgccgcggcgctgagatcctctgggaggccgtc
aacaagggcgacgactcctacatcaacgccctcggcgcactgaccggcaaccaggctgtc
cagcaggtccgcgcaggcctgaaggctgtctacctctccggttggcaggtcgcaggtgac
gccaacctctctggccacacctacccggaccagtccctgtacccggctaactccgtgccg
aacgttgttcagcgcatcaacaacgctctgatgcgcgccgacgagatcgctcgcgtcgag
ggcgatgactccgtcgagaactggctcgtcccgatcgtcgctgacggtgaggccggcttc
ggtggcgctctgaacgtctacgagctgcagaaggccatgatcaaggctggcgccgctggc
tcccactgggaggaccagctcgcttccgagaagaagtgtggccacctgggcggcaaggtc
ctgatcccgacccagcagcacgttcgtaccctgaacgctgctcgtctggcagctgacgtt
gctaacaccccgaccctggtcgtcgcacgtaccgacgccgaggctgcaaccctgctgacc
tccgacgtcgatgaccgcgacaagccgttcctgaccggcggccgtaccgctgagggcttc
tacaacgtccagaacggcatcgagccatgcatcgctcgtgcgaaggcatacgctccgtac
gctgacctcatctggatggagaccggcaccccggacctcgagctggctaagaagttcgcc
gaggcggtccacgaggagtacccagaccagctgctggcctacaactgctccccgtccttc
aactggtccgcacacctcgaggcagacgagatcgccaagttccagaacgagctgggcgca
atgggcttcaagttccagttcatcaccctggctggcttccacgccctgaactactccatg
ttcgacctggcttacggctacgctcgcgagcagatgaccgcattcgtcgacctgcagaac
cgcgagttcaaggctgccgaggagcgcggcttcaccgccgtcaggcaccagcgcgaggtc
ggtgcaggctacttcgacgccatcgcaaccaccgtcgacccgaactcctccaccaccgcc
ctgaagggctccaccgaggagggccagttctaa

DBGET integrated database retrieval system