KEGG   Corynebacterium urealyticum DSM 7109: cur_0191Help
Entry
cur_0191          CDS       T00685                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0191
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cur_0191
Enzymes [BR:cur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     cur_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(239868..241160)
Genome map
AA seq 430 aa AA seqDB search
MSTVGTPRTAAEIQKDWDENPRWAQVKRDYTAEQVAELQGNVLEEHTLARRGAEILWEAV
NKGDDSYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
NVVQRINNALMRADEIARVEGDDSVENWLVPIVADGEAGFGGALNVYELQKAMIKAGAAG
SHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVANTPTLVVARTDAEAATLLT
SDVDDRDKPFLTGGRTAEGFYNVQNGIEPCIARAKAYAPYADLIWMETGTPDLELAKKFA
EAVHEEYPDQLLAYNCSPSFNWSAHLEADEIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAYGYAREQMTAFVDLQNREFKAAEERGFTAVRHQREVGAGYFDAIATTVDPNSSTTA
LKGSTEEGQF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgtcggaactccacgtaccgcagctgaaatccagaaggactgggacgagaac
ccgcgctgggcacaggtcaagcgtgactacaccgctgagcaggtcgcagagctccagggc
aacgtcctcgaggagcacaccctcgcacgccgcggcgctgagatcctctgggaggccgtc
aacaagggcgacgactcctacatcaacgccctcggcgcactgaccggcaaccaggctgtc
cagcaggtccgcgcaggcctgaaggctgtctacctctccggttggcaggtcgcaggtgac
gccaacctctctggccacacctacccggaccagtccctgtacccggctaactccgtgccg
aacgttgttcagcgcatcaacaacgctctgatgcgcgccgacgagatcgctcgcgtcgag
ggcgatgactccgtcgagaactggctcgtcccgatcgtcgctgacggtgaggccggcttc
ggtggcgctctgaacgtctacgagctgcagaaggccatgatcaaggctggcgccgctggc
tcccactgggaggaccagctcgcttccgagaagaagtgtggccacctgggcggcaaggtc
ctgatcccgacccagcagcacgttcgtaccctgaacgctgctcgtctggcagctgacgtt
gctaacaccccgaccctggtcgtcgcacgtaccgacgccgaggctgcaaccctgctgacc
tccgacgtcgatgaccgcgacaagccgttcctgaccggcggccgtaccgctgagggcttc
tacaacgtccagaacggcatcgagccatgcatcgctcgtgcgaaggcatacgctccgtac
gctgacctcatctggatggagaccggcaccccggacctcgagctggctaagaagttcgcc
gaggcggtccacgaggagtacccagaccagctgctggcctacaactgctccccgtccttc
aactggtccgcacacctcgaggcagacgagatcgccaagttccagaacgagctgggcgca
atgggcttcaagttccagttcatcaccctggctggcttccacgccctgaactactccatg
ttcgacctggcttacggctacgctcgcgagcagatgaccgcattcgtcgacctgcagaac
cgcgagttcaaggctgccgaggagcgcggcttcaccgccgtcaggcaccagcgcgaggtc
ggtgcaggctacttcgacgccatcgcaaccaccgtcgacccgaactcctccaccaccgcc
ctgaagggctccaccgaggagggccagttctaa

DBGET integrated database retrieval system