KEGG   Corynebacterium urealyticum DSM 7109: cur_0192Help
Entry
cur_0192          CDS       T00685                                 

Gene name
aceB1
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0192 (aceB1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cur_0192 (aceB1)
   00630 Glyoxylate and dicarboxylate metabolism
    cur_0192 (aceB1)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     cur_0192 (aceB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241598..243832
Genome map
AA seq 744 aa AA seqDB search
MGNRNTKESNMAQTQQTERVSAGGLQVAKVLYDFVNNEVLPKAGKSGEENQKKFWDGFGE
IVEKFTPRNKELLAKRDELQAKLDQWYTDHKGAQDPKEYEAFLREIGYLVDEPGEFEIAT
QNIDSEIAETAGPQLVVPILNARFALNAANARWGSLYDALYGTDAISEENGQEKGSSYNK
VRGDKVIEWGREFLDRAIPLESGSHKDVTTYSVASGQITGEIDGEQVNLRNPEVYAGYAG
EESNPSGILVRNNGLYFEIQIDPESPIGKTDKAGVKDILMESAITTIMDFEDSVAAVDAT
DKTLGYRNWLGLNVGDLSEEVEKNGKTFSRTLNEDRYYTAKDGSELRLQGRSLLFVRNVG
HLMQNPAILDANGEEIFEGIMDAVITSAAAIEGLNKDNAHRNSRTGSIYIVKPKQHGPEE
VAFTNELFGAVEDLLGLERFTLKVGVMDEERRTTANLDACIAEVKERLAFINTGFLDRTG
DEIHTSMLAGPMVRKADLQTAPWKIAYEDNNVDAGLAHGLPGKAQIGKGMWAKTELMADM
LAQKIGQPKEGASTAWVPSPTGATLHATHYHEVDVFEVQDKLRTEGRRETLGDILTLPVA
ESADWSAEEIAEEIDNNSQSILGYVVRWVEQGVGCSKIPDIHDIDLMEDRATCRINSQHL
ANWLKHGVVTEEQVLDSLQRMAAKVDQQNAGDAAYRNMAPDFDESVAFQAAKDLVFKGLE
QPAGYTEPILHARRLEFKAKNGIA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccgcaacacaaaggagtcgaatatggcccagactcagcagaccgaacgcgtc
agcgctggtggcctccaggtcgccaaggttctctatgacttcgtgaataacgaggttctt
ccgaaggctggtaagtccggcgaggaaaaccagaagaagttctgggatggcttcggcgag
atcgtcgagaagttcaccccgcgtaacaaggagctgctggccaagcgcgatgagctgcag
gccaagctcgaccagtggtacaccgaccacaagggtgctcaggacccgaaggaatacgag
gccttcctccgtgagatcggctacctggtcgacgagccgggcgagttcgagatcgcgacc
cagaacatcgatagcgagatcgcagagaccgccggcccgcagctggtcgtcccgatcctc
aacgcccgcttcgctctgaatgcggcgaacgctcgctggggctccctgtacgacgccctc
tacggcaccgacgccatctccgaggagaacggccaggagaagggcagcagctacaacaag
gtccgcggtgacaaggtcatcgagtggggccgcgagttcctggaccgcgcaatccccctg
gagtccggctctcacaaggacgtcaccacgtactccgtcgcctccggccagatcactggt
gagatcgacggcgagcaggtcaacctgcgcaacccggaggtctacgcaggctacgccggc
gaggagtccaacccgtccggcattctggtccgcaacaacggcctgtacttcgagatccag
atcgatccggagtctccgatcggtaagaccgacaaggctggcgtgaaggacatcctcatg
gagtccgccatcaccaccattatggacttcgaggactccgtcgcagccgtcgacgccacc
gacaagactctgggctaccgcaactggctcggcctgaacgtcggcgacctctccgaggaa
gttgagaagaacggcaagaccttctcccgtaccctcaacgaggaccgctactacaccgcc
aaggacggctccgagctgcgcctgcagggccgctccctgctgttcgtccgtaacgtcggt
cacctgatgcagaacccggcgatcctggatgccaacggcgaggagatcttcgagggcatc
atggatgccgtcatcacctctgcagctgcgatcgagggcctgaacaaggacaacgcacac
cgcaactcccgcaccggttcgatctacatcgtgaagccgaagcagcacggcccggaggag
gttgccttcaccaacgagctgttcggtgcagtggaggatctgctgggtctggagcggttc
actctgaaggtcggcgtgatggatgaggagcgtcgtaccaccgccaacctggatgcctgc
atcgcagaggttaaggagcgcctggcgttcattaacaccggcttcctggaccgcaccggt
gatgagatccacacctccatgctggccggcccgatggttcgcaaggcggacctgcagacc
gcgccgtggaagatcgcctacgaggacaacaacgtcgacgccggcctggcacacggcctg
ccgggcaaggctcagatcggtaagggcatgtgggccaagaccgagctgatggcggacatg
ctcgcacagaagatcggtcagccaaaggagggcgcatccaccgcgtgggttccgtccccg
accggtgcgaccctgcacgcgacccactaccacgaggtggatgtttttgaggtgcaggac
aagctgcgcaccgagggtcgtcgcgagaccctgggcgacatccttaccctgccggtggcg
gagtctgctgattggtctgctgaggagatcgccgaggagatcgacaataactcccagtcc
atcctgggttatgtggtccgctgggtggagcagggtgttggttgctccaagatcccggac
atccacgacatcgacctgatggaggaccgcgcgacctgccgcattaactcccagcacctg
gccaactggctcaagcacggcgtggtgaccgaggagcaggtcctcgactccctgcagcgt
atggctgcgaaggtcgaccagcagaacgctggggatgctgcctaccgcaacatggcgccg
gactttgacgagtctgtggctttccaggctgcgaaggatctggtgtttaagggtctggag
cagccggctggttataccgagccgatcctgcatgcacgtcgtttggagttcaaggctaaa
aacggcatcgcctaa

DBGET integrated database retrieval system