KEGG   Corynebacterium urealyticum DSM 7109: cur_0198Help
Entry
cur_0198          CDS       T00685                                 

Gene name
aceB2
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0198 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cur_0198 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    cur_0198 (aceB2)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     cur_0198 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248611..250827
Genome map
AA seq 738 aa AA seqDB search
MISNSAISQGAERVTAGGLQVAKTLYDFVNTEVLPVIGKDSAAEQEKFWDGFGKIVEEYT
PRNRELLNTRDELQKKMDAWYEDHKGAQDPEEYKAFLKEIGYLVDEPGDFEITTQNIDSE
IAETSGPQLVISALNARFALNAANARWGSLYDALYGTDAISEENGQEKGTGYNKVRGDKV
IEWGREFLDRVVPLESGSHKDVTKYAVESGQLTATIDGNDVHLREPEVYVGFGGDKANPT
DILLYNNGLHIDIQIDPESPIGKTDKAGVKDLNLESAVTTIIDFEDSVAAVDAEDKTLGY
RNWLGLNVGNLTKTITKSGRTFTRKLNEDPVFTSRDGEELRLHGRSLLFVRNVGHLMQNP
AILDQNGEEIFEGIMDAVITSAAAIPGLDENNPLRNSRTGSIYIVKPKQHGPEEVAFTNE
LFGAVEDLLGLERFTLKVGVMDEERRTTANLDACIAEVKERLAFINTGFLDRTGDEIHTS
MLAGPMVRKADLQTAPWKIAYEDNNVDAGLAHGLPGKAQIGKGMWAKTELMADMLAQKIG
QPKEGASTAWVPSPTGATLHATHYHEVDVFEVQDKLRTEGRRETLGDILTLPVAESADWS
AEEIAEEIDNNSQSILGYVVRWVEQGVGCSKIPDIHDIDLMEDRATCRINSQHLANWLKH
GVVTEEQVLDSLQRMAAKVDQQNAGDAAYRNMAPDFDESVAFQAAKDLVFKGLEQPAGYT
EPILHARRLEFKAKNGIA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaattccgctatttctcaaggtgccgagcgcgtaaccgctggcggccttcag
gttgccaagactctctatgacttcgttaacactgaggtacttcccgtcatcggcaaggat
tccgccgcggagcaggagaagttctgggatggcttcggcaagatcgtcgaggagtacacc
ccgcgtaaccgcgagctgctgaacactcgcgacgagctgcagaagaagatggacgcctgg
tatgaggatcacaagggtgctcaggatccggaggagtacaaggccttcctgaaggagatc
ggctacctggttgacgagccgggcgactttgagattacgacccagaatatagatagcgag
atcgcagagacttccggcccacagctggttatttcggcgttgaacgcccgcttcgcgctg
aacgcggcgaatgcccgctggggttctctgtacgacgctttgtacggcaccgatgctatc
tccgaggaaaacggccaggagaagggcactggttacaacaaggtccgcggtgacaaggtc
atcgagtggggtcgcgagttcctggaccgcgttgtaccgctggagtccggttcccacaag
gacgtcaccaagtacgccgtcgagtctggccagctgaccgccaccatcgacggcaacgat
gtgcacctgcgcgagcccgaggtttacgtcggcttcggcggtgacaaggccaacccgacc
gacattctgctgtacaacaacggtctgcatatcgacatccagattgacccggagtccccg
atcggcaagaccgacaaggccggtgtgaaggacctgaacctcgaatccgcagtgacgaca
attatcgattttgaagactcagtggcagctgtggatgcagaggataaaactctgggttat
cgcaactggcttgggctaaatgttggtaatctgacaaaaactattaccaagtcggggcga
accttcacccgtaagctcaacgaggatcctgtgtttacctcccgtgatggtgaggagctg
cgtctgcatggtcgttccctgctgttcgtgcgtaacgttggccacctgatgcagaacccg
gcgatcctggatcagaacggcgaggagatctttgagggcatcatggatgccgttattact
tcggctgctgcgatcccgggtctggatgagaacaacccgctgcgcaactcccgcaccggc
tccatctacatcgtgaagccgaagcagcacggcccggaggaggttgccttcaccaacgag
ctgttcggtgcagtggaggatctgctgggtctggagcggttcactctgaaggtcggcgtg
atggatgaggagcgtcgtaccaccgccaacctggatgcctgcatcgcagaggttaaggag
cgcctggcgttcattaacaccggcttcctggaccgcaccggtgatgagatccacacctcc
atgctggccggcccgatggttcgcaaggcggacctgcagaccgcgccgtggaagatcgcc
tacgaggacaacaacgtcgacgccggcctggcacacggcctgccgggcaaggctcagatc
ggtaagggcatgtgggccaagaccgagctgatggcggacatgctcgcacagaagatcggt
cagccaaaggagggcgcatccaccgcgtgggttccgtccccgaccggtgcgaccctgcac
gcgacccactaccacgaggtggatgtcttcgaggtgcaggacaagctgcgcaccgagggt
cgtcgcgagaccctgggcgacatccttaccctgccggtggcggagtctgctgattggtct
gctgaggagatcgccgaggagatcgacaataactcccagtccatcctgggttatgtggtc
cgctgggtggagcagggtgttggttgctccaagatcccggacatccacgacatcgacctg
atggaggaccgcgcgacctgccgcattaactcccagcacctggccaactggctcaagcac
ggcgtggtgaccgaggagcaggtcctcgactccctgcagcgtatggctgcgaaggtcgac
cagcagaacgctggggatgctgcctaccgcaacatggcgccggactttgacgagtctgtg
gctttccaggctgcgaaggatctggtgtttaagggtctggagcagccggctggttatacc
gagccgatcctgcatgcacgtcgtttggagttcaaggctaaaaacggcatcgcctaa

DBGET integrated database retrieval system