KEGG   Corynebacterium urealyticum DSM 7109: cur_0198Help
Entry
cur_0198          CDS       T00685                                 

Gene name
aceB2
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cur01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cur00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cur00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248611..250827
Genome map
AA seq 738 aa AA seqDB search
MISNSAISQGAERVTAGGLQVAKTLYDFVNTEVLPVIGKDSAAEQEKFWDGFGKIVEEYT
PRNRELLNTRDELQKKMDAWYEDHKGAQDPEEYKAFLKEIGYLVDEPGDFEITTQNIDSE
IAETSGPQLVISALNARFALNAANARWGSLYDALYGTDAISEENGQEKGTGYNKVRGDKV
IEWGREFLDRVVPLESGSHKDVTKYAVESGQLTATIDGNDVHLREPEVYVGFGGDKANPT
DILLYNNGLHIDIQIDPESPIGKTDKAGVKDLNLESAVTTIIDFEDSVAAVDAEDKTLGY
RNWLGLNVGNLTKTITKSGRTFTRKLNEDPVFTSRDGEELRLHGRSLLFVRNVGHLMQNP
AILDQNGEEIFEGIMDAVITSAAAIPGLDENNPLRNSRTGSIYIVKPKQHGPEEVAFTNE
LFGAVEDLLGLERFTLKVGVMDEERRTTANLDACIAEVKERLAFINTGFLDRTGDEIHTS
MLAGPMVRKADLQTAPWKIAYEDNNVDAGLAHGLPGKAQIGKGMWAKTELMADMLAQKIG
QPKEGASTAWVPSPTGATLHATHYHEVDVFEVQDKLRTEGRRETLGDILTLPVAESADWS
AEEIAEEIDNNSQSILGYVVRWVEQGVGCSKIPDIHDIDLMEDRATCRINSQHLANWLKH
GVVTEEQVLDSLQRMAAKVDQQNAGDAAYRNMAPDFDESVAFQAAKDLVFKGLEQPAGYT
EPILHARRLEFKAKNGIA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaattccgctatttctcaaggtgccgagcgcgtaaccgctggcggccttcag
gttgccaagactctctatgacttcgttaacactgaggtacttcccgtcatcggcaaggat
tccgccgcggagcaggagaagttctgggatggcttcggcaagatcgtcgaggagtacacc
ccgcgtaaccgcgagctgctgaacactcgcgacgagctgcagaagaagatggacgcctgg
tatgaggatcacaagggtgctcaggatccggaggagtacaaggccttcctgaaggagatc
ggctacctggttgacgagccgggcgactttgagattacgacccagaatatagatagcgag
atcgcagagacttccggcccacagctggttatttcggcgttgaacgcccgcttcgcgctg
aacgcggcgaatgcccgctggggttctctgtacgacgctttgtacggcaccgatgctatc
tccgaggaaaacggccaggagaagggcactggttacaacaaggtccgcggtgacaaggtc
atcgagtggggtcgcgagttcctggaccgcgttgtaccgctggagtccggttcccacaag
gacgtcaccaagtacgccgtcgagtctggccagctgaccgccaccatcgacggcaacgat
gtgcacctgcgcgagcccgaggtttacgtcggcttcggcggtgacaaggccaacccgacc
gacattctgctgtacaacaacggtctgcatatcgacatccagattgacccggagtccccg
atcggcaagaccgacaaggccggtgtgaaggacctgaacctcgaatccgcagtgacgaca
attatcgattttgaagactcagtggcagctgtggatgcagaggataaaactctgggttat
cgcaactggcttgggctaaatgttggtaatctgacaaaaactattaccaagtcggggcga
accttcacccgtaagctcaacgaggatcctgtgtttacctcccgtgatggtgaggagctg
cgtctgcatggtcgttccctgctgttcgtgcgtaacgttggccacctgatgcagaacccg
gcgatcctggatcagaacggcgaggagatctttgagggcatcatggatgccgttattact
tcggctgctgcgatcccgggtctggatgagaacaacccgctgcgcaactcccgcaccggc
tccatctacatcgtgaagccgaagcagcacggcccggaggaggttgccttcaccaacgag
ctgttcggtgcagtggaggatctgctgggtctggagcggttcactctgaaggtcggcgtg
atggatgaggagcgtcgtaccaccgccaacctggatgcctgcatcgcagaggttaaggag
cgcctggcgttcattaacaccggcttcctggaccgcaccggtgatgagatccacacctcc
atgctggccggcccgatggttcgcaaggcggacctgcagaccgcgccgtggaagatcgcc
tacgaggacaacaacgtcgacgccggcctggcacacggcctgccgggcaaggctcagatc
ggtaagggcatgtgggccaagaccgagctgatggcggacatgctcgcacagaagatcggt
cagccaaaggagggcgcatccaccgcgtgggttccgtccccgaccggtgcgaccctgcac
gcgacccactaccacgaggtggatgtcttcgaggtgcaggacaagctgcgcaccgagggt
cgtcgcgagaccctgggcgacatccttaccctgccggtggcggagtctgctgattggtct
gctgaggagatcgccgaggagatcgacaataactcccagtccatcctgggttatgtggtc
cgctgggtggagcagggtgttggttgctccaagatcccggacatccacgacatcgacctg
atggaggaccgcgcgacctgccgcattaactcccagcacctggccaactggctcaagcac
ggcgtggtgaccgaggagcaggtcctcgactccctgcagcgtatggctgcgaaggtcgac
cagcagaacgctggggatgctgcctaccgcaacatggcgccggactttgacgagtctgtg
gctttccaggctgcgaaggatctggtgtttaagggtctggagcagccggctggttatacc
gagccgatcctgcatgcacgtcgtttggagttcaaggctaaaaacggcatcgcctaa

DBGET integrated database retrieval system