KEGG   Corynebacterium urealyticum DSM 7109: cur_0215Help
Entry
cur_0215          CDS       T00685                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0215
   01230 Biosynthesis of amino acids
    cur_0215
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_0215
  Energy metabolism
   00680 Methane metabolism
    cur_0215
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cur_0215
Enzymes [BR:cur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cur_0215
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cur_0215
  Exosomal proteins of melanoma cells
   cur_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269238..270059
Genome map
AA seq 273 aa AA seqDB search
MGVSPANGVTGRRGRNVSWQNGSMSNTEGTLILLRHGQSEWNATNQFTGWVDVSLTDQGK
AEAKRAGQLIKDAAVEPTVLFTSLLRRAIMTANIALNEADRHWIPVQRDWRLNERHYGAL
QGLNKAETRDKYGEEQFMSWRRSYDTPPPQIDVDSEYAQTNDVRYADLPEVPRTECLQDV
VNRLVPYYEAEIEPRLKAGETVLVVAHGNSLRALVKHLDEISDEDIAQLNLPTGMPLVYK
FDSNGAVKVKGGEYLDPEAAAAGAAAVAAEGKK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgggagtgagccccgcgaacggggtcactggccgccggggtcgcaacgtttcatggcaa
aatggaagcatgagcaacactgaaggaacactgatcctcctccgccacgggcagagcgaa
tggaacgcaacgaatcagttcaccggctgggtggacgtcagcctcaccgaccagggcaag
gccgaggccaagcgcgctggccagctgattaaggacgccgccgtcgagccgaccgtcctg
ttcacctctctgctgcgccgcgcgatcatgaccgcgaatatcgcgctgaacgaggcggac
cgccactggatcccggtgcagcgcgactggcgcctcaacgagcgccactacggtgcgctg
cagggcctgaacaaggcagagactcgcgacaagtacggcgaagagcagttcatgtcctgg
cgtcgcagctacgacaccccgccgccgcagatcgacgtggatagcgagtacgcgcagacc
aacgacgtgcgctacgccgatctgccggaggtcccgcgcaccgagtgcctgcaggacgtc
gttaatcgcctcgtcccgtactacgaggccgagatcgagccgcgcctgaaggccggggag
accgtcctcgttgtcgcgcacggcaactccctgcgcgcgctggtcaagcacctggacgag
atctccgatgaggacatcgcccagctcaacctgccgaccggtatgccgctggtctacaag
ttcgacagcaatggtgcggtcaaggtcaagggtggcgagtacctcgacccggaggcagca
gcagccggtgcggccgccgtagccgccgagggtaagaagtaa

DBGET integrated database retrieval system