KEGG   Corynebacterium urealyticum DSM 7109: cur_0240Help
Entry
cur_0240          CDS       T00685                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cur00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cur00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299266..299970
Genome map
AA seq 234 aa AA seqDB search
MSTAELPVDLRPLDSATEPAIVDLPIAGAWLFAPRVFGDARGSFHEGFHAAQFTEHLGYP
FDVAQANVSRSSRDVVRGIHLAEVPPGQAKFVSCLAGEVVDVLVDLRVGSPTFGKHVKVA
LSESNNYAVHVPIGVGHGFVARSETAVLNYLVTEAYNPDREFGVDPFDPELGIDWGVDRA
DAVLSDKDAAAPALAEVHARLADWQEARGWEQELRREWSEALDFADSYGEHGEG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcagagctgcctgttgacttgcgtcccctggactcggccaccgagccggcc
atcgtcgaccttcccatcgccggtgcctggctcttcgccccacgggttttcggggacgct
cggggcagcttccacgagggcttccacgccgcccagttcaccgagcatctgggatacccc
ttcgacgtcgctcaggcgaacgtctcccgcagcagcagggatgtcgttcggggcatccac
ctggccgaggtaccgccggggcaggcaaagttcgtcagctgcctggccggggaggtggtc
gacgtgctggtggacttgcgggtcggttccccgaccttcggcaagcacgtcaaggtcgcc
ctcagcgagtccaataactacgcggtgcacgtgccgatcggggtggggcacggcttcgtc
gcccgctccgagaccgcggtgctgaactacctggtcaccgaggcttataacccggaccgg
gagttcggagtggaccccttcgacccggagttgggcatcgactggggcgtggaccgcgcc
gatgcggttctttccgataaggacgccgccgccccggcgctggcggaggttcacgcgcgc
ttggctgattggcaggaggcgcgtggctgggagcaggagctgcgccgggagtggtccgag
gctctcgacttcgccgatagctacggcgagcacggggagggctag

DBGET integrated database retrieval system