KEGG   Corynebacterium urealyticum DSM 7109: cur_0551Help
Entry
cur_0551          CDS       T00685                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cur_0551
   00052 Galactose metabolism
    cur_0551
   00500 Starch and sucrose metabolism
    cur_0551
   00520 Amino sugar and nucleotide sugar metabolism
    cur_0551
Enzymes [BR:cur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cur_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661545..662570
Genome map
AA seq 341 aa AA seqDB search
MGHGLLRCSCSLYGWVGGAGILNGSFPARTGCKSSIVAQLGGTMHLMTSNELRTVVVPAA
GLGTRFLPATKTVPKELLPVVDTPGIELIAKEAAQAGAERLAIITAPKKQGIMAHFRTDA
ELEATLEARGKEDQLAKVRATDGLIDVAAIEQPEPLGLGHAIGLAETHLAEDEECFAVML
PDDLVLPYGVMETMLEVRQRYGGSVLCAVEVPEEDVSKYGVFDIAADSDDPQVKKVNGMV
EKPDLEDAPSNFAATGRYLLDRQVFEALSRTKPGKGGEIQITDAIELMISEGHPVHIVVH
QGKRHDLGNPGGYIRACVDMALEDETYGESLKQWLEQRLGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggggcatggtctccttcgctgctcgtgctctctgtacgggtgggttggcggcgccgga
attctcaacggatcttttccggcccgcaccgggtgtaagtccagcattgtggcccagctg
ggcggtacgatgcacctcatgacatccaatgagcttcgcacagttgtagtccccgccgca
ggactggggacgcgcttcctgcctgcaacgaagacggtgcccaaggaactgctccccgtg
gtcgacactcccggtatcgagcttatcgccaaggaggccgcccaggctggtgcggaacgg
ctggcgatcatcaccgccccgaagaagcagggcatcatggcccacttccgcaccgatgct
gagctcgaggccaccctcgaagcccgcggtaaggaggaccagctcgcgaaggttcgcgcc
accgacggcctgatcgacgtggcagccatcgagcagccggagccactcggcctcggccac
gccatcggcctggccgaaacccacctcgccgaggatgaggaatgcttcgccgtcatgctg
ccagacgacctcgtcctgccctacggggtcatggagaccatgctggaggtgcgccagcgc
tatggtggctccgtcctgtgcgcagtcgaggtgccggaggaggacgtctccaagtacggt
gtcttcgatatcgccgccgactccgatgacccgcaggtcaagaaggtcaacggcatggtc
gagaagccggacctcgaagacgccccgtcgaacttcgcggccaccggccgctacctgctg
gaccggcaggtcttcgaggccctgtcccgcaccaagccgggcaagggtggggaaatccag
atcaccgatgccatcgagctgatgatctccgaggggcacccggtgcacatcgtcgtccac
cagggcaagcgccacgacctcggcaacccaggcggctacatccgcgcgtgcgtggacatg
gctctcgaggatgagacctacggggagtccctgaagcagtggctcgagcagcgactcggg
gagtag

DBGET integrated database retrieval system