KEGG   Corynebacterium urealyticum DSM 7109: cur_0605Help
Entry
cur_0605          CDS       T00685                                 

Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cur00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723881..724555
Genome map
AA seq 224 aa AA seqDB search
MAQSAVNPQGGGAGAASQPSGAGHALIIVDVQNDFVDGSLATERGAQAAEAISKHIAGLH
RYDVILGTKDWHIDPAGHFAPEGTEPDYQDTWPVHCVAGTTGAQSHPALATDQVEAWFHK
GEYEPAYSGFEGHLADSLAVAEAKSAAAEEARPKVLLAEWLRSRRIGQVTVVGIATDFCV
RATALDAKAEGFDVNVIPRLCAPVSAAGEEATLAELREAGIEVK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtccgctgtgaatccgcagggcggtggggccggagccgcatcccagccctct
ggggcggggcacgcgctgatcatcgttgacgtgcagaatgacttcgtcgacggcagcctg
gctaccgaacgtggcgcgcaggccgccgaagcgatcagcaagcacatcgccggcctgcac
cgttatgacgtcatcttggggacgaaggattggcacatcgacccagccgggcatttcgcc
ccggagggtacggagccggattaccaggacacctggccggtgcactgcgttgccggaacc
accggcgcacagtcgcacccggcgcttgcgaccgatcaggtcgaggcgtggttccataag
ggtgagtacgagcccgcctactcgggctttgaaggccacctcgcggactctcttgcggtc
gcggaagcgaagagcgctgctgccgaagaggcccgtccgaaggtactcctcgcggaatgg
ctgcgttcccgccgcattggtcaggtgaccgtggttggtatcgcgaccgacttctgcgtg
cgcgccaccgcgctggatgcgaaggccgagggcttcgacgtcaatgtgatcccgcgtctg
tgcgcgccggtgtcagcagcgggggaggaagcgaccctcgccgaactgcgtgaggccggt
atcgaggtgaagtag

DBGET integrated database retrieval system