KEGG   Corynebacterium urealyticum DSM 7109: cur_0605Help
Entry
cur_0605          CDS       T00685                                 

Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    cur_0605
Enzymes [BR:cur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     cur_0605
    3.5.1.-  
     cur_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
723881..724555
Genome map
AA seq 224 aa AA seqDB search
MAQSAVNPQGGGAGAASQPSGAGHALIIVDVQNDFVDGSLATERGAQAAEAISKHIAGLH
RYDVILGTKDWHIDPAGHFAPEGTEPDYQDTWPVHCVAGTTGAQSHPALATDQVEAWFHK
GEYEPAYSGFEGHLADSLAVAEAKSAAAEEARPKVLLAEWLRSRRIGQVTVVGIATDFCV
RATALDAKAEGFDVNVIPRLCAPVSAAGEEATLAELREAGIEVK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtccgctgtgaatccgcagggcggtggggccggagccgcatcccagccctct
ggggcggggcacgcgctgatcatcgttgacgtgcagaatgacttcgtcgacggcagcctg
gctaccgaacgtggcgcgcaggccgccgaagcgatcagcaagcacatcgccggcctgcac
cgttatgacgtcatcttggggacgaaggattggcacatcgacccagccgggcatttcgcc
ccggagggtacggagccggattaccaggacacctggccggtgcactgcgttgccggaacc
accggcgcacagtcgcacccggcgcttgcgaccgatcaggtcgaggcgtggttccataag
ggtgagtacgagcccgcctactcgggctttgaaggccacctcgcggactctcttgcggtc
gcggaagcgaagagcgctgctgccgaagaggcccgtccgaaggtactcctcgcggaatgg
ctgcgttcccgccgcattggtcaggtgaccgtggttggtatcgcgaccgacttctgcgtg
cgcgccaccgcgctggatgcgaaggccgagggcttcgacgtcaatgtgatcccgcgtctg
tgcgcgccggtgtcagcagcgggggaggaagcgaccctcgccgaactgcgtgaggccggt
atcgaggtgaagtag

DBGET integrated database retrieval system