KEGG   Corynebacterium urealyticum DSM 7109: cur_0738Help
Entry
cur_0738          CDS       T00685                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cur_0738
   01230 Biosynthesis of amino acids
    cur_0738
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cur_0738
   00030 Pentose phosphate pathway
    cur_0738
   00051 Fructose and mannose metabolism
    cur_0738
   00052 Galactose metabolism
    cur_0738
  Energy metabolism
   00680 Methane metabolism
    cur_0738
Enzymes [BR:cur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cur_0738
Protein phosphatases and associated proteins [BR:cur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     cur_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879352..880566
Genome map
AA seq 404 aa AA seqDB search
MPSASPSSRLLLHCWSGSWLRPSRGVPSQDQARATSVAGIRLQRNHTCRWHSSGGELEDM
RIAILTSGGDCPGLNAVIRGVVRTAGAAGVEVIGFEDGYQGLVENRVVPLYDDAYIDRII
RYGGTILGTGRLHPDKFKAQIDTIKANLAEHEVDALIPIGGDGTLRGAQFLHDNGIPVVG
IPQTIDNDVDGMDYTFGFDSAVAVATEAIDRLHTTAESHKRVMIVEVMGRHTGWIALHAG
MAGGAHDVLLPEFPFDIDEVCARMEKRFEQGERYGIICVAEGAEPKGGNLDGQGDGEEEL
DEFGHVKLQGMGYQVARAVEKRLGVEVRSSVLGHLQRGGTPTAFDRVLATRCGVNATKAV
LEGKTGKVAALHGEKIDLIDFDQAVGRVKSVPDYRYQNLQGLLG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggccagtccttcctcccgattgctgctgcactgctggtcgggctcgtggcta
cggccctctcggggagtgccaagccaggaccaggcccgcgccactagtgttgctggcata
aggctgcaacgtaaccacacgtgccggtggcacagctcgggaggagaactcgaagatatg
cgtatcgcgattttgaccagtggtggggattgccccggcttgaacgcagtgatccgtggt
gtcgtgcgcaccgcgggtgccgcaggtgttgaggtcatcggcttcgaagatggctaccag
gggctggtggaaaaccgtgtggtcccgctgtatgacgacgcctacatcgaccgcatcatt
cgttacggcggcacgattctcggtaccggccggctccaccccgataagttcaaggctcag
atcgacacgatcaaggccaacctcgcggagcatgaggtcgacgcgctgatcccgatcggt
ggtgacggcaccctgcggggcgcgcagttcctgcacgataacggcatcccggtcgtgggc
atcccgcagaccatcgataacgacgtcgatggcatggattacaccttcggcttcgactcc
gccgtcgccgtggccaccgaggccatcgaccgcctgcacaccactgcagaatcccacaag
cgcgtcatgatcgttgaggtgatgggccgccacaccggctggatcgccctgcacgcaggc
atggccggtggtgcccacgacgtcctgctgccggagttccccttcgatatcgacgaggtc
tgcgcccgcatggagaagcgcttcgagcagggcgagcgctatgggatcatctgtgtggca
gaaggcgcggaaccgaagggcggcaacctggacggccagggggatggtgaggaggaactc
gatgaattcgggcacgtcaagcttcagggcatgggctaccaagtggcccgagccgtggaa
aagcggcttggcgtggaggtgcgctcctccgttctggggcacctgcagcgcggcggcaca
ccgactgccttcgaccgggtgctggccacccgctgtggagtcaatgccaccaaggcggtg
ctcgaaggcaagaccggaaaagtggcggccctgcacggcgagaaaatcgatcttatcgac
ttcgatcaggccgtcgggcgggtgaagtccgtgcccgactaccgctaccaaaaccttcag
ggcctgctgggttaa

DBGET integrated database retrieval system